DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADRB2 and Octbeta3R

DIOPT Version :9

Sequence 1:NP_000015.2 Gene:ADRB2 / 154 HGNCID:286 Length:413 Species:Homo sapiens
Sequence 2:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster


Alignment Length:286 Identity:96/286 - (33%)
Similarity:150/286 - (52%) Gaps:33/286 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    12 LAPNGSH-APDHDVTQERDEVW-----VVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNY 70
            :..|||. |.|:..  |.:|.|     ::..|.:.|.|:||.|.||.|||.::.:..:|:.:|||
  Fly   114 ITANGSDIAVDNQA--ELEESWLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVITNY 176

Human    71 FITSLACADLVMGLAVVPFGAA-HILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFA 134
            |:.|||.||:::.|..:.|.|: .:....|.||.|.|..:.|:||...||||..||.|:||||:|
  Fly   177 FVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYA 241

Human   135 ITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRA-THQEAINCYANETCCDFFTNQA 198
            |..|.:|...:|......::..|||:..|.||.||.:.||.. .|...|:.:.::  |.|..|:|
  Fly   242 IVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEEHLREISLHPDQ--CSFVVNKA 304

Human   199 YAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSK 263
            ||:.||.|||::|.::|:.:|.|:|:||.||.:.:.::.....:.::       ..||..:.:|.
  Fly   305 YALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALSRTSSNILLNSV-------HMGHTQQPTSL 362

Human   264 FCL--------------KEHKALKTL 275
            ..|              :.|.||..|
  Fly   363 SYLHPSDCDLNATSAREETHSALSNL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADRB2NP_000015.2 7tmA_Beta2_AR 34..336 CDD:341355 88/258 (34%)
TM helix 1 36..60 CDD:341355 11/23 (48%)
TM helix 2 69..91 CDD:341355 10/21 (48%)
TM helix 3 107..129 CDD:341355 10/21 (48%)
TM helix 4 152..168 CDD:341355 6/15 (40%)
TM helix 5 197..220 CDD:341355 10/22 (45%)
TM helix 6 272..294 CDD:341355 2/4 (50%)
TM helix 7 305..330 CDD:341355
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..413
PDZ-binding 410..413
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 79/201 (39%)
7tm_1 156..>344 CDD:278431 74/189 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 230 1.000 Domainoid score I2451
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40768
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.