DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa2 and E5

DIOPT Version :10

Sequence 1:NP_034581.1 Gene:Hoxa2 / 15399 MGIID:96174 Length:372 Species:Mus musculus
Sequence 2:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster


Alignment Length:122 Identity:32/122 - (26%)
Similarity:48/122 - (39%) Gaps:31/122 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse    23 PPAMQVPAQVSQYPDAPPPYSEVYQPRYM---APPPAPGQMPQMTSAYPGTQMYMPMHAQTVPMG 84
            |..:.:|||             .::||::   .||.|....|:..:         |..||     
  Fly    25 PVVIHLPAQ-------------HHRPRFLGQVVPPRAVNAAPRAPA---------PTIAQ----- 62

Mouse    85 AMASSVPMAYYPMG-PVYPPGSTVMVDGGFDAGARFGPGTGSSIPPPPPGHLPNAAQ 140
            ..|.:||....|:. |..||.:...|....:....|.|..|::||||||.::|...|
  Fly    63 EKAIAVPQPQQPIALPPAPPAAQQPVLPVTNGDQSFAPRVGAAIPPPPPVNIPTDVQ 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa2NP_034581.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..95 12/49 (24%)
Antp-type hexapeptide 96..101 2/5 (40%)
Homeodomain 140..196 CDD:459649 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..225
E5NP_524825.1 Homeodomain 304..360 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.