DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa2 and Ubx

DIOPT Version :9

Sequence 1:NP_034581.1 Gene:Hoxa2 / 15399 MGIID:96174 Length:372 Species:Mus musculus
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:195 Identity:66/195 - (33%)
Similarity:90/195 - (46%) Gaps:32/195 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse    68 GAGVGGRPKSSPAGSRGSPVPAGALQPPE----YPWM-----------KEKKAAKKTALPPAAAS 117
            |||.......:.:|:......|.:|....    ||||           |.|..:..|.....:..
  Fly   207 GAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTD 271

Mouse   118 TGPACLGHKESLE---IAD--GSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLD 177
            .|..   :.|||.   :.|  |:.|..||.|..||..|.||||||||.|.||.|.||:|:|..|.
  Fly   272 MGKR---YSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALC 333

Mouse   178 LTERQVKVWFQNRRMKHKRQTQCKENQNSEGKFKNLEDSDKVEEDEEEKSLFEQALSVSGALLER 242
            |||||:|:||||||||.|::.|.         .|.|.:.:|..:.::..:....|.:|.|..|::
  Fly   334 LTERQIKIWFQNRRMKLKKEIQA---------IKELNEQEKQAQAQKAAAAAAAAAAVQGGHLDQ 389

Mouse   243  242
              Fly   390  389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa2NP_034581.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..95 6/26 (23%)
Antp-type hexapeptide 96..101 4/19 (21%)
Homeobox 143..195 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..225 5/30 (17%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.