DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa2 and zen2

DIOPT Version :9

Sequence 1:NP_034581.1 Gene:Hoxa2 / 15399 MGIID:96174 Length:372 Species:Mus musculus
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:253 Identity:74/253 - (29%)
Similarity:116/253 - (45%) Gaps:71/253 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse   139 SRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKEN 203
            |:|.|||:::.||:|||:|||.||||.|.||:||:..|.|||||||:||||||||.|:.|     
  Fly    43 SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKST----- 102

Mouse   204 QNSEGKFKNL--------EDSDKVEEDEEEKSLFEQALSVSGALLEREGYTFQQNALSQQQAPNG 260
             |.:|....|        :.|:.:::|::   :.|:.|..:...:|         ....:|..:|
  Fly   103 -NRKGAIGALTTSIPLSSQSSEDLQKDDQ---IVERLLRYANTNVE---------TAPLRQVDHG 154

Mouse   261 HNGDSQTFPVSPLTSNEKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEAIEVPSLQDFNVFS 325
            ...:.|..|  |..|.:.                          |:..|||.:.:|.| .||.|.
  Fly   155 VLEEGQITP--PYQSYDY--------------------------LHEFSPEPMALPQL-PFNEFD 190

Mouse   326 TD---SCLQLSDALSPSLP--------GSLDSPVDISADSFDFFTDTLTTIDLQHLNY 372
            .:   |.|    .|.|::|        .:.|.|: |....:|..:.:.::.|:..::|
  Fly   191 ANWASSWL----GLEPTIPIAENVIEHNTQDQPM-IQNFCWDSNSSSASSSDILDVDY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa2NP_034581.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..95
Antp-type hexapeptide 96..101
Homeobox 143..195 CDD:278475 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..225 7/38 (18%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/52 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.