DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa10 and unpg

DIOPT Version :9

Sequence 1:NP_032289.2 Gene:Hoxa10 / 15395 MGIID:96171 Length:416 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:311 Identity:78/311 - (25%)
Similarity:114/311 - (36%) Gaps:87/311 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse   130 PPDGPPPPQPQPQQQQQQPPPPPP------QPPQPQPQATSCSFAQNIKEESSYCLYDAADKCPK 188
            |...|...|||.|.|.|.|||.||      |.|...|......|                  .|.
  Fly   114 PAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRF------------------LPF 160

Mouse   189 GSAAADLAPFPRGPPPDGCALGASSGVPVPGYFRLSQ-----------AYGTAKGFGSGGGGTQQ 242
            ..|||.:||...                  .|.||::           .:...:...:.|...:.
  Fly   161 NPAAAGVAPTDL------------------SYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHED 207

Mouse   243 LASPFPAQPPGRGFDPPPALASGSTEAAGK----ERVLDSTPPPTLVCTGGGGS----------- 292
            .|:|..||..    :|.|..|..|...:|.    |..||........|:|...|           
  Fly   208 QANPGMAQLQ----EPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNY 268

Mouse   293 --QGDEEAHASSSAAEELSPAPSENSKASPE------KDSLGSSKGENAANWLTAKSGRKKRCPY 349
              :.|:..:.:.:.::....:..|.:::..|      |||.|:....|:       ..|::|..:
  Fly   269 NGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNS-------KSRRRRTAF 326

Mouse   350 TKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKM 400
            |..|.||||:||....||:...|.:|:.|:.|::.||||||||||.|.|::
  Fly   327 TSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa10NP_032289.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..60
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..167 16/42 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..345 25/139 (18%)
Homeobox 345..398 CDD:278475 26/52 (50%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/50 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.