DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa1 and Ubx

DIOPT Version :9

Sequence 1:NP_034579.3 Gene:Hoxa1 / 15394 MGIID:96170 Length:336 Species:Mus musculus
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:428 Identity:100/428 - (23%)
Similarity:155/428 - (36%) Gaps:162/428 - (37%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 MNSFLE-------YP------ILGSG----DSGTCSARAYPSDHGITTFQSCAVSANSCGGDDRF 53
            |||:.|       :|      .:|||    .:.:.:|.||                         
  Fly     1 MNSYFEQASGFYGHPHQATGMAMGSGGHHDQTASAAAAAY------------------------- 40

Mouse    54 LVGRGVQIS---SPHHHHHHHHHHHPQTATYQTSGNLGISYSHSSCGPSYGAQNFSAPYGPYGLN 115
               ||..:|   ||      :.:||.|..|..:..:..|:   ::|...||  :.:..|....||
  Fly    41 ---RGFPLSLGMSP------YANHHLQRTTQDSPYDASIT---AACNKIYG--DGAGAYKQDCLN 91

Mouse   116 QEADVSGGY-------------------------------------------------------P 125
            .:||...||                                                       .
  Fly    92 IKADAVNGYKDIWNTGGSNGGGGGGGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPS 156

Mouse   126 PCAP-AVYSGNLSTPMVQHHHHHQGYAGGTVGSPQYIHHSYGQEQQTLALA----TYNNSLSPLH 185
            .|.| :...|.|.|.......|..|.|||.| |....:.:.|..|..:.:|    .:|.:.:...
  Fly   157 ACTPDSRVGGYLDTSGGSPVSHRGGSAGGNV-SVSGGNGNAGGVQSGVGVAGAGTAWNANCTISG 220

Mouse   186 ASHQEACRSPASETSSPAQTF-DWMKV----KRNPPKT---GKVGEYGYVGQ------------- 229
            |:.|.|..|...:.|:  .|| .||.:    ..:|.|:   ..:.:||.:..             
  Fly   221 AAAQTAAASSLHQASN--HTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGS 283

Mouse   230 --PNAVRTN---------FTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRM 283
              |:.:.||         :|..|..|||||||.|.||||.||:|:|.:|.|.|.|:|||||||||
  Fly   284 LLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRM 348

Mouse   284 KQKKREKEGLLPISPATPPGSDEKTEESSEKSSPSPSA 321
            |.|| |.:.:..:       ::::.:..::|::.:.:|
  Fly   349 KLKK-EIQAIKEL-------NEQEKQAQAQKAAAAAAA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa1NP_034579.3 COG5576 177..>287 CDD:227863 49/141 (35%)
Homeobox 234..287 CDD:365835 34/61 (56%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.