DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa1 and unpg

DIOPT Version :9

Sequence 1:NP_034579.3 Gene:Hoxa1 / 15394 MGIID:96170 Length:336 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:243 Identity:70/243 - (28%)
Similarity:96/243 - (39%) Gaps:70/243 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    68 HHHHHHHHPQTATYQTSGNLGIS--------YSHSSCGPSYGAQNFSAPYGPYGLNQEADVSGGY 124
            |....|.......::...|.|::        .:|||...| |:.:...|....|::::.:.||  
  Fly   192 HARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKS-GSHSPMEPALDVGMDEDFECSG-- 253

Mouse   125 PPCAPAVYSGNLSTPMVQHHHHHQGYAGGTVGSPQYIHHSYGQEQQTLALATYNNSLSPLHASHQ 189
            ..|:      ::|..|                ||:    :|..|........|.||.|       
  Fly   254 DSCS------DISLTM----------------SPR----NYNGEMDKSRNGAYTNSDS------- 285

Mouse   190 EACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYVGQPNAV---------RTNFTTKQLTEL 245
            |.|.......|.              .:.|.:|  |...|.|..         ||.||::||.||
  Fly   286 EDCSDDEGAQSR--------------HEGGGMG--GKDSQGNGSSSNSKSRRRRTAFTSEQLLEL 334

Mouse   246 EKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGL 293
            |:|||..|||:...|.:||.||:|:|.||||||||||.|. ||.|.||
  Fly   335 EREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKW-KRVKAGL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa1NP_034579.3 COG5576 177..>287 CDD:227863 45/118 (38%)
Homeobox 234..287 CDD:365835 33/52 (63%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.