DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnrnpab and Rb97D

DIOPT Version :9

Sequence 1:NP_001041526.1 Gene:Hnrnpab / 15384 MGIID:1330294 Length:332 Species:Mus musculus
Sequence 2:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster


Alignment Length:276 Identity:86/276 - (31%)
Similarity:134/276 - (48%) Gaps:41/276 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse    63 DQINASKNEED-------AGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGF 120
            |.|..:..|||       ..|:|:|||:..|::::||.::.::|:|||..:..|..|.|||||||
  Fly    13 DVIVLADREEDDICELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGF 77

Mouse   121 ILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKD-------PVKKIFVGGLNPEATEEKIREY 178
            |.:..|..|::..:.:.|.:||:.::.|:|:...:.       .|||:|||||.....||.:|||
  Fly    78 ITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREY 142

Mouse   179 FGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKEVY--- 240
            |.|||.:.:::|..|....|||||.|:.|.:.|.|.|.:.||.|.:.....::|    |.:|   
  Fly   143 FLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVK----KSIYNLD 203

Mouse   241 QQQQYGSGGRGNR-----NRGNRGSGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSP--- 297
            ::::...||..|.     |:..:..||||...........:......||..||    |...|   
  Fly   204 KKEKQQPGGLANAIKPSLNQQQQQQGGGQQPPNGNMQAPSFRPPVPPQQAMGP----YQQQPPPA 264

Mouse   298 --------YGYYGYGP 305
                    :.|:|..|
  Fly   265 PMSAPPPNFNYWGPPP 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HnrnpabNP_001041526.1 CBFNT 1..75 CDD:285369 5/18 (28%)
RRM1_hnRNPAB 76..150 CDD:241201 28/73 (38%)
RRM2_hnRNPAB 155..234 CDD:241028 33/85 (39%)
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 29/76 (38%)
RRM2_hnRNPA_like 124..196 CDD:240774 30/71 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.