DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnrnpab and CG4612

DIOPT Version :9

Sequence 1:NP_001041526.1 Gene:Hnrnpab / 15384 MGIID:1330294 Length:332 Species:Mus musculus
Sequence 2:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster


Alignment Length:255 Identity:59/255 - (23%)
Similarity:119/255 - (46%) Gaps:46/255 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse    18 NGHEAAPEGEAPVEPSAAAAAPAASAGSGGGTTTAPSGNQNGAEGDQINASKNEEDAGKMFVGGL 82
            :||.:...|.      .:.::.:|:.|.|.|.....||:..|:.|:      :..|:||:::..|
  Fly    68 HGHNSLGSGH------TSTSSHSANVGVGVGGGALASGSTGGSGGN------SSPDSGKIYIKNL 120

Mouse    83 SWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEKVLDQKEHRLDGRVIDP 147
            ......|.:.|.|:.||.:::|.:..|.: |.|||:||:.|....:....::    :::|.:.:.
  Fly   121 ERSIDNKAVYDTFSVFGNILNCNVAKDED-GNSRGYGFVHFDSEEAARAAIE----KVNGMLCNN 180

Mouse   148 KKAMAMKKDP-----------VKKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRG 201
            :|...:|..|           .|.::|..|:.|.||:.:||.|..:|.|.:.:|.:|.:...|| 
  Fly   181 QKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRR- 244

Mouse   202 FVFITFKEEDPV-----------KKVLEKKF----HTVSGSKCEIKVAQPKEVYQQQQYG 246
            |.|:.:  |:|.           |::.:.||    ..:|.::.:.::.:..|..::|:.|
  Fly   245 FGFVAY--ENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKAG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HnrnpabNP_001041526.1 CBFNT 1..75 CDD:285369 12/56 (21%)
RRM1_hnRNPAB 76..150 CDD:241201 17/73 (23%)
RRM2_hnRNPAB 155..234 CDD:241028 24/104 (23%)
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/74 (23%)
RRM3_I_PABPs 202..282 CDD:240826 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.