DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTNL9 and tutl

DIOPT Version :9

Sequence 1:XP_024310148.1 Gene:BTNL9 / 153579 HGNCID:24176 Length:564 Species:Homo sapiens
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:617 Identity:122/617 - (19%)
Similarity:206/617 - (33%) Gaps:210/617 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    14 VSLTSSLVFLMHLLLLQPGEPSSEVKVLGPEYPILALVGEEVEFPCHLWPQLDAQQM----EIRW 74
            ||.|:.::.....:::.|  |:::.|          |.||:|.|.|      :|:.|    .:||
  Fly   333 VSHTARVIIAGGAVIMVP--PTNQTK----------LEGEKVIFSC------EAKAMPGNVTVRW 379

Human    75 FRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQLHSIIPSDKGTYGCRFHSDN 139
            :|..:             |.|::.|...|..:.||    ||::  ::.|.|.|.|.|.|      
  Fly   380 YREGS-------------PVREVAALETRVTIRKD----GSLI--INPIKPDDSGQYLC------ 419

Human   140 FSGEALWELEVA-GLGSDP-----HLSLEGFKEGGIQLRLRSSGWYP-----KPKVQWRDHQ--- 190
                     ||. |:| ||     :||:|                ||     .|.||:...:   
  Fly   420 ---------EVTNGIG-DPQSASAYLSVE----------------YPAKVTFTPTVQYLPFRLAG 458

Human   191 -GQCL---PPEFEAIVWDAQ----DLFSLETSVVVRAGALSNVSVSIQNLLLSQKKELVVQIADV 247
             .||.   .|:.:.:.|...    :.:.::..||:..|:|....|:.::    |.:.........
  Fly   459 VVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSLLFTRVNEEH----QGQYACTPYNAQ 519

Human   248 FVPGASAWKSAFVATLPLLLVLAALALGVLRKQRRSREKLRKQAEKRQEKLTAELEKLQTELDWR 312
            ...|||......|...|...|         ..:...:.|:....|...:.|.||..:..| :.|:
  Fly   520 GTAGASGVMDVLVRKPPAFTV---------EPETLYQRKVGDSVEMHCDALEAEGTERPT-IKWQ 574

Human   313 RAEGQAEWRAAQKYAEKREVCPPWGRHGRGPDRPGRALTL----------WLCAVDVTLDPASAH 367
            |.||:   :..:....:.::             .|..:|:          :.|.|...:....|.
  Fly   575 RQEGE---QLTESQRNRIKI-------------SGGNITIENLRREDFGYYQCVVSNEVATLMAV 623

Human   368 PSLEVSEDGKSVSSRGAPPGPAPGHPQ----RFSEQTCALS-LERFSAGRHYWEVHVGRRSRWFL 427
            ..|.:.             |..|..|.    :.:|.:..|. |..:|.|..|.:.:    :.||.
  Fly   624 TQLVIE-------------GTQPHAPYNITGKATESSITLQWLPGYSGGSEYKQDY----TIWFR 671

Human   428 GACL-----AAVPRAGPARLSPAAGYWVLGLWNGCEY-FVLAPHRV--------ALTLRV----- 473
            .|.:     .:|..:|..:::      :.||.:|..| |.:....|        .:|:|.     
  Fly   672 EAGVNDWQTISVTPSGSTQVT------INGLASGTTYEFQVVGRNVLGDGMMSKVMTVRTLEDAP 730

Human   474 -----------PPRRLGVFLDYEAGELSFFNVSDGSHIFTFHDTFSGALCAYFRPRAHDGGEHPD 527
                       ||......:..||..|::|::       .||....|.| .|..|:....|..|.
  Fly   731 AAPRNVKAATQPPDSFFQLMPDEADLLAYFDI-------YFHTDSRGTL-VYSPPKLRVKGPKPG 787

Human   528 PLTICPLPVRGTGVPEENDS--DTWLQPYEPA 557
                   |.|...|.|.::.  .||..|.|.|
  Fly   788 -------PPRNVSVTEVSNGFLITWQSPLERA 812

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTNL9XP_024310148.1 Ig_MOG_like 52..151 CDD:319291 25/102 (25%)
bZIP <281..317 CDD:328730 9/35 (26%)
SPRY_PRY_C-I_1 358..532 CDD:293968 38/208 (18%)
tutlNP_001303307.1 V-set 137..250 CDD:284989
IG_like 137..229 CDD:214653
I-set 253..341 CDD:254352 3/7 (43%)
IGc2 268..331 CDD:197706
I-set 346..437 CDD:254352 35/143 (24%)
Ig 349..437 CDD:299845 35/140 (25%)
Ig 459..530 CDD:299845 13/74 (18%)
IG_like 549..628 CDD:214653 16/95 (17%)
IGc2 551..617 CDD:197706 13/82 (16%)
FN3 633..725 CDD:238020 20/101 (20%)
FN3 786..874 CDD:238020 10/34 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.