DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTNL9 and Dscam1

DIOPT Version :9

Sequence 1:XP_024310148.1 Gene:BTNL9 / 153579 HGNCID:24176 Length:564 Species:Homo sapiens
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:410 Identity:88/410 - (21%)
Similarity:140/410 - (34%) Gaps:107/410 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   107 VKDD--IAYGSVVLQLHSIIPSDKGTYGCRFHSDNFSGEALWELEVAGLGSDPHLSLEGFK---- 165
            :||.  |.:...||::.|:...|||.|.|...:|..|.||..||::.| ..||.:..:.|:    
  Fly   381 MKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKLGG-RFDPPVIRQAFQEETM 444

Human   166 EGGIQLRLRS-SGWYPKPKVQWRDHQGQCLPPEFEAIVWDAQDLFSLETSVVVRAGALSNVSVS- 228
            |.|..:.|:. :|..|.|::.|          |.:.......|.:.:...|.|....:|.:::: 
  Fly   445 EPGPSVFLKCVAGGNPTPEISW----------ELDGKKIANNDRYQVGQYVTVNGDVVSYLNITS 499

Human   229 -------IQNLLLSQKKELVVQIADVFVPG----ASAWKSAFVA--TLPLLLVLAALALGVLRKQ 280
                   :...:...|..:....|.:.|.|    ....|.|.||  ||.:...:|...:..:..:
  Fly   500 VHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGETLIVTCPVAGYPIDSIVWE 564

Human   281 RRSREKLRKQAEKRQEKLTAELEKLQTELDWRRAEGQAEWRAAQKYAEKREVCPPWGRHGRG--- 342
            |.:|.....:.:|.....|..:|.::...|      ||.:....|..|        |...||   
  Fly   565 RDNRALPINRKQKVFPNGTLIIENVERNSD------QATYTCVAKNQE--------GYSARGSLE 615

Human   343 ------PD----------RPGRALTLWLCAVDVTLDPASAHPSLEVSEDGKSVSSRGAPPGPAPG 391
                  |.          ..|.::.|: |.:.....|...|.|.|     :|....|........
  Fly   616 VQVMVLPQIVPFAYEDLINMGDSIDLF-CQIQKGDRPIKVHWSFE-----RSAGDYGFDQVQPQM 674

Human   392 HPQRFSEQTCALSLERFSAGRHYWEVHVGRRSRWFLGACLAAVPRAGPARLSPAAGYWVLGLWNG 456
            ...|.||:|..:|:...|      ..|.||      ..|:|: .:||....|             
  Fly   675 RTNRISEKTSMISIPSAS------PAHTGR------DTCIAS-NKAGTTTYS------------- 713

Human   457 CEYFVLAPHRVALTLRVPPR 476
                      |.||:.||||
  Fly   714 ----------VDLTVNVPPR 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTNL9XP_024310148.1 Ig_MOG_like 52..151 CDD:319291 17/45 (38%)
bZIP <281..317 CDD:328730 6/35 (17%)
SPRY_PRY_C-I_1 358..532 CDD:293968 27/119 (23%)
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653 16/43 (37%)
IGc2 361..413 CDD:197706 11/31 (35%)
I-set 433..527 CDD:254352 15/103 (15%)
IGc2 446..517 CDD:197706 12/80 (15%)
I-set 533..618 CDD:254352 20/98 (20%)
IGc2 544..607 CDD:197706 13/76 (17%)
Ig 641..714 CDD:143165 22/114 (19%)
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.