DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTNL9 and LOC100492877

DIOPT Version :9

Sequence 1:XP_024310148.1 Gene:BTNL9 / 153579 HGNCID:24176 Length:564 Species:Homo sapiens
Sequence 2:XP_031747063.1 Gene:LOC100492877 / 100492877 -ID:- Length:488 Species:Xenopus tropicalis


Alignment Length:502 Identity:136/502 - (27%)
Similarity:221/502 - (44%) Gaps:75/502 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    16 LTSSLVFLMHLLLLQPGEPSSEVKVLGPEYPILALVGEEVEFPCHLWPQLDAQQMEIRWFRSQTF 80
            :...|:||.  |:..|...|.:..|..|...::|.:|..|..||.|.|.|.|..:|:|||.:...
 Frog     1 MAGPLLFLS--LIFLPPPLSGQFHVTSPNKQLVAELGSNVSLPCTLSPPLSADGLEVRWFHTIYS 63

Human    81 NVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQLHSIIPSDKGTYGCRFHSDNFSG--- 142
            ..|:|.::.:|...:|...:..|..|:|...: |.:.|.||.:..||...|.| |..:..||   
 Frog    64 PHVYLLKDGKEDKEQQRAEYNGRVSLLKGPES-GDLTLSLHKVQLSDANNYVC-FVENKTSGVYE 126

Human   143 EALWELEVAGLGSDPHLSLEGFKEGGIQLRLRSSGWYPKPKVQWRDHQGQCLPPEFEAIVWDAQD 207
            ||..:|:|.|.||.|.|.: ..::..:.|...||||||||::||...:|..:.|...|.:..:..
 Frog   127 EAFIQLDVVGEGSLPTLDI-SLQDSSVLLSFSSSGWYPKPQMQWEKSEGVSIAPNSVAYLNQSDG 190

Human   208 LFSLETSVVVRAGALSNVSVSIQNLLLSQKKELVVQIADVFVPGASAWKSAFVATLPLLLVLAAL 272
            ||.:|:|::::......:....::.:..:...:.::|:....|..|.|..|||:.  .:|:||.:
 Frog   191 LFRVESSILLKGPYTDPLYCRARHPITGRDTGIFLRISGDLFPHVSPWAYAFVSV--FILMLAGV 253

Human   273 ALGVLRKQRRSREKLRKQAEKRQEKLTAELEKLQTELDWRRAEGQAEWRAAQKYAEKREVCPPWG 337
            .:.:|..:|...||         |.||:::..|.:|:|||:|                 |..|  
 Frog   254 GVAILCARRLLNEK---------EMLTSKVAHLSSEMDWRKA-----------------VMQP-- 290

Human   338 RHGRGPDRPGRALTLWLCAVDVTLDPASAHPSLEVSEDGKSVSSRGAPPGPAPGHPQRFSEQTCA 402
                               |....:|...||.|.||.|..|:.:: .|..|...:..||..:.|.
 Frog   291 -------------------VYFMFNPDITHPELSVSTDCLSLYNK-PPVSPPRMNKVRFETERCC 335

Human   403 LSLERFSAGRHYWEVHVGRRSRWFLGACLAAVPRAGPARLSPAAGYWVLG----LWNGCEYF--V 461
            |....||:|.|||||.:.:...|.:|.....|.|.|.|        ::.|    :|..|.:.  .
 Frog   336 LGDYTFSSGAHYWEVELIQGEEWAVGVASPKVQRKGAA--------YMFGPQEKIWCVCRFVETF 392

Human   462 LAPHRVALTLRVPP---RRLGVFLDYEAGELSFFNVSDGSHIFTFHD 505
            .|.......|.|..   :|:||:|:.....:||::.:...|::||.|
 Frog   393 KALDNTEYNLDVTADIFKRVGVYLNLTKHTVSFYDPTTWKHLYTFSD 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTNL9XP_024310148.1 Ig_MOG_like 52..151 CDD:319291 33/101 (33%)
bZIP <281..317 CDD:328730 12/35 (34%)
SPRY_PRY_C-I_1 358..532 CDD:293968 44/157 (28%)
LOC100492877XP_031747063.1 Ig 21..134 CDD:416386 36/114 (32%)
FR1 21..44 CDD:409353 7/22 (32%)
Ig strand A 22..26 CDD:409353 1/3 (33%)
Ig strand A' 29..33 CDD:409353 0/3 (0%)
Ig strand B 36..44 CDD:409353 3/7 (43%)
CDR1 45..53 CDD:409353 3/7 (43%)
Ig strand C 53..58 CDD:409353 2/4 (50%)
FR2 54..58 CDD:409353 2/3 (67%)
CDR2 59..77 CDD:409353 3/17 (18%)
Ig strand C' 63..71 CDD:409353 2/7 (29%)
Ig strand C' 72..75 CDD:409353 0/2 (0%)
FR3 79..118 CDD:409353 13/40 (33%)
Ig strand D 86..91 CDD:409353 2/4 (50%)
Ig strand E 96..104 CDD:409353 3/7 (43%)
Ig strand F 111..119 CDD:409353 3/8 (38%)
CDR3 119..123 CDD:409353 0/3 (0%)
Ig strand G 123..134 CDD:409353 4/10 (40%)
FR4 124..134 CDD:409353 3/9 (33%)
SPRY 294..460 CDD:413402 44/155 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I34420
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 247 1.000 Inparanoid score I11407
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D175892at32523
OrthoFinder 1 1.000 - - FOG0001727
OrthoInspector 1 1.000 - - otm72290
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X198
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.