DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnx1 and Antp

DIOPT Version :9

Sequence 1:NP_064328.2 Gene:Mnx1 / 15285 MGIID:109160 Length:404 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:284 Identity:84/284 - (29%)
Similarity:105/284 - (36%) Gaps:98/284 - (34%)


- Green bases have known domain annotations that are detailed below.


Mouse    87 AHCALLPKPGFLGAGGGGGAA------------GGPGTPHHHAHPGAAAAAAAAAAAAAAGGLAL 139
            |.|.|....|.||....||:.            .....|||..||           .|..|...:
  Fly   160 ASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHP-----------QAQLGYTDV 213

Mouse   140 GL----------HPGG---AQGG---AGLPAQAALYGHPVYSYSAAAAAAALAGQHPALSYSYPQ 188
            |:          |..|   .|.|   .|.|.|..::                .||.|      ||
  Fly   214 GVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMH----------------QGQGP------PQ 256

Mouse   189 VQGAHPAHPADPIKLGASTFQLDQWLRASTAGMILPKMPDFSSQAQSNLLGKC---RRPRTAFTS 250
            :...||.....|          .|...:.::||..|..|...||     .|||   :|.|..:|.
  Fly   257 MHQGHPGQHTPP----------SQNPNSQSSGMPSPLYPWMRSQ-----FGKCQERKRGRQTYTR 306

Mouse   251 QQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKG 315
            .|.||||.:|..|:||:|.:|.|:|.:|.|||.|:||||||||||||:..|.|            
  Fly   307 YQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK------------ 359

Mouse   316 GGGGTGKGGSEEKTEEELMGPPVS 339
              |..|.||     |.:.:.||.|
  Fly   360 --GEPGSGG-----EGDEITPPNS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mnx1NP_064328.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..80
Homeobox 244..297 CDD:278475 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..404 10/41 (24%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 42/192 (22%)
Homeobox 301..354 CDD:395001 31/52 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.