DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnx1 and ftz

DIOPT Version :9

Sequence 1:NP_064328.2 Gene:Mnx1 / 15285 MGIID:109160 Length:404 Species:Mus musculus
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:163 Identity:52/163 - (31%)
Similarity:76/163 - (46%) Gaps:16/163 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse   180 PALSYSYPQVQGAHPAHPADPIKLGASTFQLDQWLRASTAGMILPK-MPDFS-SQAQSNLLGKC- 241
            |....|.|.::|. ...|..|.:..:|....:...|..||    |. ..||: |..:..|...| 
  Fly   193 PTTPTSLPPLEGI-STPPQSPGEKSSSAVSQEINHRIVTA----PNGAGDFNWSHIEETLASDCK 252

Mouse   242 --RRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKE 304
              :|.|..:|..|.||||.:|..|:|::|.:|.::|.:|.|:|.|:|||||||||      |:|:
  Fly   253 DSKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRM------KSKK 311

Mouse   305 QAAQEAEKQKGGGGGTGKGGSEEKTEEELMGPP 337
            ....::..:..|.|.|......|.|.....|.|
  Fly   312 DRTLDSSPEHCGAGYTAMLPPLEATSTATTGAP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mnx1NP_064328.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..80
Homeobox 244..297 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..404 9/39 (23%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 14/59 (24%)
Homeobox 257..310 CDD:278475 27/58 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.