DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2ax and His2A:CG33829

DIOPT Version :9

Sequence 1:NP_034566.1 Gene:H2ax / 15270 MGIID:102688 Length:143 Species:Mus musculus
Sequence 2:NP_001027326.1 Gene:His2A:CG33829 / 3772447 FlyBaseID:FBgn0053829 Length:124 Species:Drosophila melanogaster


Alignment Length:121 Identity:109/121 - (90%)
Similarity:116/121 - (95%) Gaps:1/121 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILE 65
            |||||| |||.:.||||||:||||||||||:|||||||:||||||||||||||||:|||.||:||
  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64

Mouse    66 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKS 121
            |||||||||||||||||||||||||||||||||.|||||||||||||||||||||:
  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2axNP_034566.1 PTZ00017 1..130 CDD:185399 109/121 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 15/20 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..143 0/1 (0%)
[ST]-Q motif 140..141
His2A:CG33829NP_001027326.1 PTZ00017 16..124 CDD:185399 97/105 (92%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I4550
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3559
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 1 1.000 - - mtm8862
orthoMCL 1 0.900 - - OOG6_100077
Panther 1 1.100 - - O PTHR23430
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2143
SonicParanoid 1 1.000 - - X55
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.