DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hint1 and HINT1

DIOPT Version :9

Sequence 1:NP_032274.1 Gene:Hint1 / 15254 MGIID:1321133 Length:126 Species:Mus musculus
Sequence 2:NP_001259964.1 Gene:HINT1 / 33471 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster


Alignment Length:126 Identity:84/126 - (66%)
Similarity:102/126 - (80%) Gaps:0/126 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MADEIAKAQVAQPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISV 65
            ||.|:.|:|.|....|||||||:|||||.|.|.|||:|:||||::|||||||||||:|.|:|:|:
  Fly    25 MASEVEKSQTAAASEDTIFGKILRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLVIPRKPIAQLSL 89

Mouse    66 ADDDDESLLGHLMIVGKKCAADLGLKRGYRMVVNEGADGGQSVYHIHLHVLGGRQMNWPPG 126
            |:|.|..||||||:||:|.|.:|||..|||:|:|.|..|.|||||:|||.||||||.||||
  Fly    90 AEDGDADLLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFLGGRQMQWPPG 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hint1NP_032274.1 PKCI_related 16..118 CDD:238607 69/101 (68%)
Histidine triad motif 110..114 2/3 (67%)
HINT1NP_001259964.1 PKCI_related 40..142 CDD:238607 69/101 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4460
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3904
Inparanoid 1 1.050 187 1.000 Inparanoid score I3906
Isobase 1 0.950 - 0.861654 Normalized mean entropy S1022
OMA 1 1.010 - - QHG60959
OrthoDB 1 1.010 - - D1190598at2759
OrthoFinder 1 1.000 - - FOG0001332
OrthoInspector 1 1.000 - - oto94499
orthoMCL 1 0.900 - - OOG6_100377
Panther 1 1.100 - - LDO PTHR23089
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2151
SonicParanoid 1 1.000 - - X1204
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.820

Return to query results.
Submit another query.