DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CXADR and cxadr

DIOPT Version :9

Sequence 1:NP_001329.1 Gene:CXADR / 1525 HGNCID:2559 Length:365 Species:Homo sapiens
Sequence 2:XP_012812297.2 Gene:cxadr / 496497 XenbaseID:XB-GENE-922483 Length:366 Species:Xenopus tropicalis


Alignment Length:363 Identity:228/363 - (62%)
Similarity:271/363 - (74%) Gaps:3/363 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     4 LLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVD 68
            :|..:||......|..|....|:.:| ..:|:...|.|||||.|||.|.|||||.:..:|.|:.|
 Frog     6 VLWLLLLSSASMSALQLVAPDPKTLI-LPQGDKVDLDCKFTLDPEDTGTLDIEWSLVASDTQQTD 69

Human    69 QVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKI 133
            |.|:.::|||.| ..|.:|||||||.|.|.|||||||.:.||:.||.|||||||||.||||:|:|
 Frog    70 QQILTFAGDKTY-TMYDELKGRVHFVSLDPKSGDASIEIINLKQSDSGTYQCKVKKVPGVASKRI 133

Human   134 HLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVIS 198
            .|.|||||:..||||:||:|||.||.:|||.|:|:.||.|.|||:|...|.......:.|:.|:.
 Frog   134 TLSVLVKPAKTRCYVEGSQEIGRDFSLKCESKDGTTPLTYTWQKISGQDKNSPPVPLDATTGVLP 198

Human   199 VKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIAGAIIGTLLALALIGLIIFCCRKK 263
            |||||.||||||.|...||||||:|||.|||.||||.||.||||:|||||.|.|:.||||||.:|
 Frog   199 VKNASKEYSGTYRCLSHNRVGSDECLLILNVAPPSNVAGKIAGAVIGTLLGLILLALIIFCCCRK 263

Human   264 RREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFER 328
            ::|:||||||.|:|||||.|||||.||||||||||||||||:||||||||||.|||::|||:|||
 Frog   264 QKEKKYEKEVQHEIREDVAPPKSRNSTARSYIGSNHSSLGSLSPSNMEGYSKAQYNKIPSEEFER 328

Human   329 TP-QSPTLPPAKVAAPNLSRMGAIPVMIPAQSKDGSIV 365
            .| .:|...|:|||.||||||||||||||||:||||:|
 Frog   329 PPSHAPNSVPSKVAGPNLSRMGAIPVMIPAQNKDGSVV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CXADRNP_001329.1 IgV_CAR_like 20..136 CDD:409552 64/115 (56%)
Ig strand B 37..41 CDD:409552 1/3 (33%)
Ig strand C 54..58 CDD:409552 3/3 (100%)
Ig strand E 103..107 CDD:409552 3/3 (100%)
Ig strand F 117..122 CDD:409552 4/4 (100%)
Ig strand G 130..133 CDD:409552 1/2 (50%)
IG 155..229 CDD:214652 40/73 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..343 57/74 (77%)
PDZ-binding 360..365 4/4 (100%)
cxadrXP_012812297.2 Ig 34..135 CDD:416386 61/101 (60%)
Ig strand B 36..46 CDD:409353 4/9 (44%)
CDR1 46..54 CDD:409353 5/7 (71%)
Ig strand C 54..60 CDD:409353 5/5 (100%)
FR2 55..60 CDD:409353 4/4 (100%)
CDR2 61..88 CDD:409353 10/27 (37%)
Ig strand C' 70..76 CDD:409353 2/5 (40%)
Ig strand C' 79..82 CDD:409353 2/3 (67%)
FR3 89..123 CDD:409353 24/33 (73%)
Ig strand D 90..93 CDD:409353 2/2 (100%)
Ig strand E 101..110 CDD:409353 5/8 (63%)
Ig strand F 116..124 CDD:409353 7/7 (100%)
Ig strand F 116..124 CDD:409353 7/7 (100%)
CDR3 124..127 CDD:409353 1/2 (50%)
FR4 128..135 CDD:409353 4/6 (67%)
Ig strand G 128..135 CDD:409353 4/6 (67%)
Ig 155..223 CDD:416386 36/67 (54%)
Ig strand B 158..162 CDD:409353 1/3 (33%)
Ig strand C 172..180 CDD:409353 4/7 (57%)
Ig strand C' 180..182 CDD:409353 0/1 (0%)
Ig strand D 187..192 CDD:409353 0/4 (0%)
Ig strand E 195..199 CDD:409353 1/3 (33%)
Ig strand F 209..214 CDD:409353 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I17186
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1024
Inparanoid 1 1.050 404 1.000 Inparanoid score I9040
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG39098
OrthoDB 1 1.010 - - D199337at32523
OrthoFinder 1 1.000 - - FOG0001092
OrthoInspector 1 1.000 - - oto154008
Panther 1 1.100 - - LDO PTHR44468
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10006
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.080

Return to query results.
Submit another query.