DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CXADR and CG33543

DIOPT Version :9

Sequence 1:NP_001329.1 Gene:CXADR / 1525 HGNCID:2559 Length:365 Species:Homo sapiens
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:255 Identity:53/255 - (20%)
Similarity:92/255 - (36%) Gaps:83/255 - (32%)


- Green bases have known domain annotations that are detailed below.


Human     4 LLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVD 68
            |..|.||..     :.:|....|::....:|..|.:.|            .:|.:.:|       
  Fly   141 LASFELLVN-----QKISFGKTEQVQSVREGRDAMVNC------------FVEGMPAP------- 181

Human    69 QVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKI 133
            :|..||:|     :|...:....|   |.|.:|   :.:.|:..:|.|.|.|:..:         
  Fly   182 EVSWLYNG-----EYINTVNSTKH---NRLSNG---LYIRNVSQADAGEYTCRAMR--------- 226

Human   134 HLVVLVKPSGARCYVDGSEEIGSDFKIKCEPK---EGSLPLQYEW----QKLS-DSQKMPT---S 187
                 :.|:     ...|::|....:|:.:|.   ..:||:||.:    ..|| |:...|.   :
  Fly   227 -----ITPT-----FSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFT 281

Human   188 WLAEMTSSV----------------ISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVP 231
            ||......|                :.:||||.  .|.|.|.|.|.:|..:.:::|...|
  Fly   282 WLHNNKGIVGFNHRIFVADYGATLQLQMKNASQ--FGDYKCKVANPLGMLERVIKLRPGP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CXADRNP_001329.1 IgV_CAR_like 20..136 CDD:409552 21/115 (18%)
Ig strand B 37..41 CDD:409552 1/3 (33%)
Ig strand C 54..58 CDD:409552 1/3 (33%)
Ig strand E 103..107 CDD:409552 0/3 (0%)
Ig strand F 117..122 CDD:409552 2/4 (50%)
Ig strand G 130..133 CDD:409552 0/2 (0%)
IG 155..229 CDD:214652 24/100 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..343
PDZ-binding 360..365
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 19/88 (22%)
IG_like 256..336 CDD:214653 20/81 (25%)
IGc2 263..327 CDD:197706 16/65 (25%)
FN3 341..445 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.