DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CXADR and Cxadr

DIOPT Version :10

Sequence 1:NP_001329.1 Gene:CXADR / 1525 HGNCID:2559 Length:365 Species:Homo sapiens
Sequence 2:NP_001020363.1 Gene:Cxadr / 13052 MGIID:1201679 Length:365 Species:Mus musculus


Alignment Length:365 Identity:328/365 - (89%)
Similarity:345/365 - (94%) Gaps:0/365 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQ 65
            ||.|||||||||:.||...|||||||:.|||||||||||||||||||||||||||||||||:|||
Mouse     1 MARLLCFVLLCGIADFTSGLSITTPEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPSDNQ 65

Human    66 KVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVAN 130
            .|||||||||||||||:|||||||||||||||:||||||||||||||||||||||||||||||||
Mouse    66 IVDQVIILYSGDKIYDNYYPDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVAN 130

Human   131 KKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSS 195
            ||..|.|||||||.||:||||||||:|||:||||||||||||:|||||||||.|||.|||||||.
Mouse   131 KKFLLTVLVKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSDSQTMPTPWLAEMTSP 195

Human   196 VISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIAGAIIGTLLALALIGLIIFCC 260
            |||||||||||||||||||:||||||||:|||:||||||:||.||||:|||||||.|||.|:|||
Mouse   196 VISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPPSNRAGTIAGAVIGTLLALVLIGAILFCC 260

Human   261 RKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSED 325
            .:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   261 HRKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSED 325

Human   326 FERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQSKDGSIV 365
            |||.||||||.||||||||||||||:||||||||||||||
Mouse   326 FERAPQSPTLAPAKVAAPNLSRMGAVPVMIPAQSKDGSIV 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CXADRNP_001329.1 IgV_CAR_like 20..136 CDD:409552 107/115 (93%)
FR1 20..44 CDD:409552 21/23 (91%)
Ig strand A 20..22 CDD:409552 1/1 (100%)
Ig strand A' 26..31 CDD:409552 2/4 (50%)
Ig strand B 35..45 CDD:409552 9/9 (100%)
CDR1 45..53 CDD:409552 7/7 (100%)
Ig strand C 53..59 CDD:409552 5/5 (100%)
FR2 54..59 CDD:409552 4/4 (100%)
CDR2 60..88 CDD:409552 24/27 (89%)
Ig strand C' 69..75 CDD:409552 5/5 (100%)
Ig strand C' 78..81 CDD:409552 2/2 (100%)
FR3 89..123 CDD:409552 32/33 (97%)
Ig strand D 90..93 CDD:409552 2/2 (100%)
Ig strand E 101..110 CDD:409552 8/8 (100%)
Ig strand F 116..124 CDD:409552 7/7 (100%)
Ig strand F 116..124 CDD:409552 7/7 (100%)
CDR3 124..127 CDD:409552 2/2 (100%)
FR4 128..136 CDD:409552 5/7 (71%)
Ig strand G 128..136 CDD:409552 5/7 (71%)
IG_like 155..229 CDD:214653 65/73 (89%)
Ig strand B 158..162 CDD:409353 2/3 (67%)
Ig strand C 172..178 CDD:409353 4/5 (80%)
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 4/4 (100%)
Ig strand G 222..225 CDD:409353 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..343 71/73 (97%)
PDZ-binding 360..365 4/4 (100%)
CxadrNP_001020363.1 IgV_CAR_like 20..136 CDD:409552 107/115 (93%)
FR1 20..44 CDD:409552 21/23 (91%)
Ig strand A 20..22 CDD:409552 1/1 (100%)
Ig strand A' 26..31 CDD:409552 2/4 (50%)
Ig strand B 35..45 CDD:409552 9/9 (100%)
CDR1 45..53 CDD:409552 7/7 (100%)
Ig strand C 53..59 CDD:409552 5/5 (100%)
FR2 54..59 CDD:409552 4/4 (100%)
CDR2 60..88 CDD:409552 24/27 (89%)
Ig strand C' 69..75 CDD:409552 5/5 (100%)
Ig strand C' 78..81 CDD:409552 2/2 (100%)
FR3 89..123 CDD:409552 32/33 (97%)
Ig strand D 90..93 CDD:409552 2/2 (100%)
Ig strand E 101..110 CDD:409552 8/8 (100%)
Ig strand F 116..124 CDD:409552 7/7 (100%)
Ig strand F 116..124 CDD:409552 7/7 (100%)
CDR3 124..127 CDD:409552 2/2 (100%)
FR4 128..136 CDD:409552 5/7 (71%)
Ig strand G 128..136 CDD:409552 5/7 (71%)
Ig 147..229 CDD:472250 72/81 (89%)
Ig strand B 158..162 CDD:409353 2/3 (67%)
Ig strand C 172..178 CDD:409353 4/5 (80%)
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 4/4 (100%)
Ig strand G 222..225 CDD:409353 2/2 (100%)
TM_EGFR-like 238..271 CDD:213052 25/32 (78%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..315 45/45 (100%)
PDZ-binding. /evidence=ECO:0000250 360..365 4/4 (100%)

Return to query results.
Submit another query.