DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF11 and side

DIOPT Version :9

Sequence 1:NP_001340247.1 Gene:IGSF11 / 152404 HGNCID:16669 Length:481 Species:Homo sapiens
Sequence 2:NP_001247334.1 Gene:side / 43300 FlyBaseID:FBgn0016061 Length:986 Species:Drosophila melanogaster


Alignment Length:607 Identity:122/607 - (20%)
Similarity:189/607 - (31%) Gaps:234/607 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    22 RGQHTSGPAGGRGV------------IQDMYSQLAVGKKTERDRHVGRSLYWGPSCYPSVAASLE 74
            |...|..|..|:.:            :|.:.|..|..:..:..:::...|.|             
  Fly    50 RKSRTRCPDNGKTIWAVGFTLVLLTCLQQLKSVSADEESQDFQKNIPARLVW------------- 101

Human    75 VSESPGSIQVARGQPAVLPCTFT--TSAALINLNVIWMV----TPLSNANQ--------PEQVIL 125
                     .|.|:...|||..|  ||...:.| ::|..    .||.:.:.        |...|.
  Fly   102 ---------AALGKTVELPCDLTPPTSQDSVKL-LLWFKDTTGIPLYSLDSRGGNVKLAPHAAIA 156

Human   126 YQGGQMFDGAPRFHGRVGFT-GTMPATNVSIFINNTQLSDTGTYQCLVN--NLPDIGGRNIGVTG 187
            ...||          |:.|: |..|..: .:.||:.:..|.|.|:|.|:  |.|....|:    .
  Fly   157 SDLGQ----------RLFFSIGDNPKDS-RLQINDVKPEDGGVYRCRVDFFNSPTRNFRH----N 206

Human   188 LTVLVPPSAPH---------CQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTL-------- 235
            ||::|||..|.         .|:.|....|.::.|.|....|.|.|...|.:.|..|        
  Fly   207 LTLVVPPEEPRIFDAQGKEISQMAGPFREGYELFLCCQVRGGRPPPKVTWWRDDTELIGTSHTSV 271

Human   236 ----------KLPPTATQD--------QVQGT---------VTIR-------------------- 253
                      .|..|.|:|        :.|||         ||::                    
  Fly   272 EEGATVMVNQLLIGTTTRDFYGIRIECRAQGTRLVDPVRKDVTVQVYLKPVRVKIATPNELLTAG 336

Human   254 ---NISALSSGLYQCV----------ASNAIGT----------STCLLDLQVISP--------QP 287
               .|...|.|.|...          ..||..|          :|.:|.|:|.|.        :.
  Fly   337 QPMPIRCESWGSYPAAKITWLLDGEPIRNAEVTVHSDKEDGNITTSILTLKVTSENDNAELTCRA 401

Human   288 RNIGLIAGAIGTGAVIIIF---CIALILGAFFYWRSKNKE-------EEEEEIPNEIREDDLPPK 342
            .|.....|||....:|.:.   .:::.|.        |::       .|.:.:..:.|.|..||.
  Fly   402 TNPWFSGGAIEDKRIIRVAYPPTVSVHLA--------NEDPSRLVTRAEGQNVTFKCRADARPPV 458

Human   343 CS--------------------------SAKAFHTEISSSDNNTLTSSNAYNSRYWSNNPKVHRN 381
            .|                          ||.|:....::::..|.:||.....::   :|:....
  Fly   459 TSYSWFKNGMRMSGESTEIMHLTQLERESAGAYACGATNTEGETRSSSLTLKVQF---SPRCKSG 520

Human   382 TESVSHFSDLGQSFSFHS------GNANIP-SIYANGTHLVPGQHKTLVVTANRGSSPQVMSR-- 437
            ||..|    :| :.|.||      .:|:.| |:..:.|:           ...|..||.:.||  
  Fly   521 TEQTS----IG-AVSLHSILVKCEVDADPPDSVRFSWTY-----------NNTRNVSPVLNSRIQ 569

Human   438 SNGSVSRKPRPPHTHSYTISHA 459
            |||..|.....|.|.|..|:.|
  Fly   570 SNGLASTVTYLPQTDSELITLA 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF11NP_001340247.1 V-set 77..191 CDD:311561 32/130 (25%)
Ig_3 208..269 CDD:316449 22/128 (17%)
sideNP_001247334.1 V-set 95..211 CDD:284989 34/153 (22%)
IG_like 100..211 CDD:214653 33/148 (22%)
Ig 235..301 CDD:299845 13/65 (20%)
Ig 326..408 CDD:299845 13/81 (16%)
IG_like 329..407 CDD:214653 13/77 (17%)
IG_like 435..511 CDD:214653 12/75 (16%)
Ig_2 442..511 CDD:290606 12/68 (18%)
FN3 <700..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.