DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF11 and Ama

DIOPT Version :9

Sequence 1:NP_001340247.1 Gene:IGSF11 / 152404 HGNCID:16669 Length:481 Species:Homo sapiens
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:217 Identity:51/217 - (23%)
Similarity:87/217 - (40%) Gaps:50/217 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    68 SVAASLEVS---ESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGG 129
            ||..|:|.:   |..|.:.|:.   |..|....|::.::::..|     ||..:|...|.:.:| 
  Fly    45 SVGDSVEFNCTVEEVGQLSVSW---AKRPSESDTNSVVLSMRNI-----LSLPDQRYNVTVTEG- 100

Human   130 QMFDGAPRFHGRVGFTGTMPATNVSIF---INNTQLSDTGTYQC--LVNNLPDIGGRNIGVTGLT 189
                               |.|..:|:   |.|.::||.|.|:|  ||:....:..:    ..|.
  Fly   101 -------------------PKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKK----LSLQ 142

Human   190 VLVPP----SAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTV 250
            :..||    :.|...:...   |.::.|.|.: .|.|:||..|.:..|.:.  |.......:.|:
  Fly   143 IKTPPVIAENTPKSTLVTE---GQNLELTCHA-NGFPKPTISWAREHNAVM--PAGGHLLAEPTL 201

Human   251 TIRNISALSSGLYQCVASNAIG 272
            .||::..:..|.|.|:|.|..|
  Fly   202 RIRSVHRMDRGGYYCIAQNGEG 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF11NP_001340247.1 V-set 77..191 CDD:311561 25/118 (21%)
Ig_3 208..269 CDD:316449 17/60 (28%)
AmaNP_731114.2 I-set 33..143 CDD:254352 29/129 (22%)
Ig 37..127 CDD:299845 26/109 (24%)
IG_like 154..234 CDD:214653 20/76 (26%)
IGc2 161..223 CDD:197706 18/67 (27%)
I-set 254..330 CDD:254352
IGc2 254..322 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.