DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF11 and dpr13

DIOPT Version :9

Sequence 1:NP_001340247.1 Gene:IGSF11 / 152404 HGNCID:16669 Length:481 Species:Homo sapiens
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:303 Identity:58/303 - (19%)
Similarity:102/303 - (33%) Gaps:73/303 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    14 LSLHDPERRGQHTSGPAGGRGVIQDMYSQLAVGKKTERDRHVGRSLYWGPSCYPSVAASLEVSES 78
            :.:|.||....|.....|..|.::.::               |..:|:|             :|:
  Fly   145 IPVHRPEPVENHLEANNGIEGGMESLF---------------GTPMYFG-------------TEN 181

Human    79 PGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVG 143
            ...:....|..|.:|||.......:   |.|:       .:.:..:|..|...:....||..   
  Fly   182 STVVTTQIGATAHVPCTVHHIGEGV---VSWI-------RKKDYHLLTVGLTTYSSDERFSA--- 233

Human   144 FTGTMPATNVSIFINNTQLSDTGTYQCLVNNLP--------DIGGRNIGVTG--LTVLVPPSAPH 198
             |....:.:.::.|...||.|.|.|:|.|:..|        .:......:||  :..|.|     
  Fly   234 -THLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPPIRYLTP----- 292

Human   199 CQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTL------KLPPTATQDQVQGT-VTIRNIS 256
                     ||.:.|.|...:......|::...||.:      :....:|:...|.: :||:...
  Fly   293 ---------GSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTR 348

Human   257 ALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAGAIGT 299
            ...||.:.|||||....|..:...:..:|.....|.:.|:..|
  Fly   349 REHSGNFTCVASNTQPASVLVHIFKGDNPAAMYHGHVGGSTKT 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF11NP_001340247.1 V-set 77..191 CDD:311561 24/123 (20%)
Ig_3 208..269 CDD:316449 16/67 (24%)
dpr13NP_001033956.2 V-set 180..276 CDD:284989 22/109 (20%)
IG_like 182..262 CDD:214653 19/93 (20%)
IG_like 285..362 CDD:214653 19/90 (21%)
IGc2 292..361 CDD:197706 17/82 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.