DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF11 and DIP-beta

DIOPT Version :9

Sequence 1:NP_001340247.1 Gene:IGSF11 / 152404 HGNCID:16669 Length:481 Species:Homo sapiens
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:178 Identity:45/178 - (25%)
Similarity:74/178 - (41%) Gaps:15/178 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   157 INNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDI--GSDVILLCSSEE 219
            |...::.|.|.|.|.||..|    ..:....|.|::||...:.:..|...:  |....|:|.: .
  Fly   178 IRGVKMEDAGKYMCQVNTDP----MKMQTATLEVVI
PPDIINEETSGDMMVPEGGSAKLVCRA-R 237

Human   220 GIPRPTYLWEKLDNTLKLPPTATQDQ-----VQG-TVTIRNISALSSGLYQCVASNAI-GTSTCL 277
            |.|:|...|.:.|....:....:..:     |:| .:|:..|:....|.|.|:|||.: .|.:..
  Fly   238 GHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKR 302

Human   278 LDLQV-ISPQPRNIGLIAGAIGTGAVIIIFCIALILGAFFYWRSKNKE 324
            :.||| ..|..:....:.||.....|.:|..:.....|..||:.:|.|
  Fly   303 MKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEASPKAINYWQRENGE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF11NP_001340247.1 V-set 77..191 CDD:311561 9/33 (27%)
Ig_3 208..269 CDD:316449 16/66 (24%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 10/34 (29%)
ig 102..195 CDD:278476 6/16 (38%)
IG_like 219..307 CDD:214653 21/88 (24%)
Ig 221..307 CDD:299845 20/86 (23%)
Ig 311..404 CDD:299845 10/40 (25%)
IG_like 327..405 CDD:214653 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.