DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Foxj1 and FoxK

DIOPT Version :9

Sequence 1:NP_032266.3 Gene:Foxj1 / 15223 MGIID:1347474 Length:421 Species:Mus musculus
Sequence 2:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster


Alignment Length:305 Identity:88/305 - (28%)
Similarity:126/305 - (41%) Gaps:88/305 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    53 PPGGTDPHGYHQVPGLVAPGSPLAADPACLGQPHTPGK-----PTSSCTSRSAPPG------LQA 106
            ||.|...|       |:|...|....|..:..|....|     ||.:.::.::.|.      :|.
  Fly   366 PPAGAAAH-------LIAGDGPGIYSPLKISIPKKEQKSPYLSPTGTISAANSCPASPRQGFIQN 423

Mouse   107 PP-----------------PDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDN 154
            .|                 |....|  |.:.|||||||.||..|:.|:...::|||.||.:|..:
  Fly   424 QPNNYNNYGNNNTQDLFQTPSTASY--NHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKH 486

Mouse   155 FCYFR-HADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPV 218
            :.|:| ..:..||||||||||||:.||||.|.:||||||.||||||....:|:..::|||     
  Fly   487 YPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKR----- 546

Mouse   219 HIHPAFARQASQEPSAAPWGGPLTV--------NREAQQLLQE--FEEATGEGGWGTGE------ 267
                   ||.|.:....|:|.|.:.        |......||:  .:.|.|..|....:      
  Fly   547 -------RQRSSQGFRPPYGMPRSAPVSPSHMDNSRESSPLQDIVLQSAPGSPGMSLEQRAADPE 604

Mouse   268 ----GRLGHKRKQPLPKRVAKVLRPPSTLLLTQEEQGELEPLKGN 308
                .:..|:::|                  .|::|.:.:.|..|
  Fly   605 IIYNSQNAHQQQQ------------------QQQQQQQQQTLSNN 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Foxj1NP_032266.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..110 8/60 (13%)
Forkhead 121..205 CDD:365978 48/84 (57%)
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 49/86 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.