DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTSZ and CG5367

DIOPT Version :9

Sequence 1:NP_001327.2 Gene:CTSZ / 1522 HGNCID:2547 Length:303 Species:Homo sapiens
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:280 Identity:76/280 - (27%)
Similarity:125/280 - (44%) Gaps:64/280 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    27 FRRGQTCYRPLRGDGLAPLGRSTYPRPHEYL-----------------SP--ADLPKSWDWRNVD 72
            ::.|||.:| |:.:..|.:....|.:....|                 ||  |::|:|.|||:..
  Fly    74 YKEGQTSFR-LKPNIFADMSTDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKG 137

Human    73 GVNYASITRNQHIPQY----CGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDC----GNA 129
            .:.          |.|    ||||:|.:...::..:: .||.|...|  ||.|.::||    ||.
  Fly   138 FIT----------PPYNQLSCGSCYAFSIAESIMGQV-FKRTGKILS--LSKQQIVDCSVSHGNQ 189

Human   130 GSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYG 194
            | |.||:..:...|....|        ...:||:.....:.|.| :|....::.|.|.|.:    
  Fly   190 G-CVGGSLRNTLSYLQSTG--------GIMRDQDYPYVARKGKC-QFVPDLSVVNVTSWAI---- 240

Human   195 SLSGREK--MMAEIYANGPISCGIMATERLAN-YTGGIYAE-YQDTTYINHVVSVAGWGISDGTE 255
             |..|::  :.|.:...||::..|.|:.:... |:.|||.: ...:..:||.:.|.|:    |.:
  Fly   241 -LPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSASVNHAMVVIGF----GKD 300

Human   256 YWIVRNSWGEPWGERGWLRI 275
            |||::|.||:.|||.|::||
  Fly   301 YWILKNWWGQNWGENGYIRI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTSZNP_001327.2 Peptidase_C1A_CathepsinX 62..302 CDD:239149 65/226 (29%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 6/22 (27%)
Peptidase_C1A 128..336 CDD:239068 65/225 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.