DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey2 and E(spl)m3-HLH

DIOPT Version :9

Sequence 1:NP_038932.1 Gene:Hey2 / 15214 MGIID:1341884 Length:339 Species:Mus musculus
Sequence 2:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster


Alignment Length:300 Identity:59/300 - (19%)
Similarity:103/300 - (34%) Gaps:103/300 - (34%)


- Green bases have known domain annotations that are detailed below.


Mouse    49 RKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGS--AKLEKAEILQMTVDHLKMLQATGG--- 108
            ||..:.::|::||.|||..|.:|:.|:....:::|.  .:||||:||::||||::.|:..||   
  Fly    12 RKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSL 76

Mouse   109 KGYF-----------DAHALATDFMSIGFRECLTEVARYLSSVEGLDPSDPLRVRLVSHLSTCAS 162
            :|..           .||  ...|.| |:.....::.:.|...:   .:|.:..:::..|||...
  Fly    77 QGVVAGVGSPPTSTSTAH--VESFRS-GYVHAADQITQVLLQTQ---QTDEIGRKIMKFLSTRLI 135

Mouse   163 QREAAVMTSSMAHHHHPLHPHHWAAAFHHLPTALLQPNGLHTSESTPCRLSTSSEVPSAHGSALL 227
            :.:..::........|                                   ...::|.:.|    
  Fly   136 ELQTQLLQQQQQQQQH-----------------------------------QQQQIPQSSG---- 161

Mouse   228 TATFAHADSALRMPSGGTVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPSN 292
                     .|..|..|...|                  |||||..:..||         :...:
  Fly   162 ---------RLAFPLLGGYGP------------------AAAAAAISYSSF---------LTSKD 190

Mouse   293 AAAAAAVAAATAISPPLSVSAASSPQQTSTGTNNKPYQPW 332
            ...........|:|...|||:..|      |.:...::||
  Fly   191 ELIDVTSVDGNALSETASVSSQES------GASEPVWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hey2NP_038932.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 2/2 (100%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000269|PubMed:11486045 47..116 27/82 (33%)
HLH 49..105 CDD:238036 23/57 (40%)
ORANGE 120..165 CDD:128787 8/44 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..339 6/22 (27%)
YQPW motif 329..332 0/2 (0%)
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 23/57 (40%)
ORANGE 96..136 CDD:128787 8/43 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830864
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.