DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey1 and E(spl)m8-HLH

DIOPT Version :9

Sequence 1:NP_034553.2 Gene:Hey1 / 15213 MGIID:1341800 Length:299 Species:Mus musculus
Sequence 2:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster


Alignment Length:173 Identity:45/173 - (26%)
Similarity:77/173 - (44%) Gaps:17/173 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse    39 MSPTTSSQVLARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKM 103
            |..||.:|:. :|.::.::|::||.|:|..|..|:.||.......|..:::|||:|:..|..::.
  Fly     1 MEYTTKTQIY-QKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQ 64

Mouse   104 LHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHL----NNYASQ 164
            ..|. .|...:..:|.:|....|:...:.||:|.::...|:  |..|...:::||    .|....
  Fly    65 QKTP-KKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGM--SVDLGKSVMTHLGRVYKNLQQF 126

Mouse   165 REAASGAH--------GGLGHIPWGSA-FGHHPHIAHPLLLPQ 198
            .||.|.|.        ..:...|...| .|:|.....|...||
  Fly   127 HEAQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQ 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hey1NP_034553.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 5/13 (38%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 48..117 18/68 (26%)
HLH 50..107 CDD:238036 16/56 (29%)
ORANGE 120..166 CDD:128787 11/49 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..234 2/5 (40%)
YRPW motif 289..292
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 16/57 (28%)
ORANGE 81..125 CDD:128787 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830843
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.