Sequence 1: | NP_034553.2 | Gene: | Hey1 / 15213 | MGIID: | 1341800 | Length: | 299 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014577.1 | Gene: | h / 38995 | FlyBaseID: | FBgn0001168 | Length: | 337 | Species: | Drosophila melanogaster |
Alignment Length: | 341 | Identity: | 77/341 - (22%) |
---|---|---|---|
Similarity: | 117/341 - (34%) | Gaps: | 133/341 - (39%) |
- Green bases have known domain annotations that are detailed below.
Mouse 50 RKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGS--AKLEKAEILQMTVDHLKMLHTAGGKGY 112
Mouse 113 FDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNN---------YASQREAA 168
Mouse 169 SGAHGGLGHIPWGSAFGHHPHIAHPLLLPQNGHGNAGTAASPTEPHHQGRLASAHP-------EA 226
Mouse 227 PALRAP----------PSGGLGPVLP---------------------------VVTSASKLSPPL 254
Mouse 255 LS--------------SVASLSAFPFSFSSFHLLSPS------------------TPTQAANLG- 286
Mouse 287 ----------KPYRPW 292 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hey1 | NP_034553.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..53 | 1/2 (50%) | |
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 | 48..117 | 30/68 (44%) | |||
HLH | 50..107 | CDD:238036 | 29/58 (50%) | ||
ORANGE | 120..166 | CDD:128787 | 14/54 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 194..234 | 8/56 (14%) | |||
YRPW motif | 289..292 | 1/2 (50%) | |||
h | NP_001014577.1 | HLH | 29..88 | CDD:238036 | 28/55 (51%) |
ORANGE | 106..141 | CDD:128787 | 13/40 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |