DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTSW and CG5367

DIOPT Version :9

Sequence 1:NP_001326.3 Gene:CTSW / 1521 HGNCID:2546 Length:376 Species:Homo sapiens
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:377 Identity:97/377 - (25%)
Similarity:153/377 - (40%) Gaps:69/377 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     9 CLLAL----LVAGLAQGIRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHN 69
            ||..|    :.:.|::|          .......|..|:.|:...||.||...:.......|..|
  Fly     9 CLCGLNCQIVTSNLSEG----------NSSSANCKSEFEKFKNNNNRKYLRTYDEMRSYKAFEEN 63

Human    70 L----AQAQRLQEEDLGTAEFGVTP--FSDLTEEEFGQLYGYRR-----AAGGVPSMGREIRSEE 123
            .    ...|..:|   |...|.:.|  |:|::.:  |.|.|:.|     ......:|. ||....
  Fly    64 FKVIEEHNQNYKE---GQTSFRLKPNIFADMSTD--GYLKGFLRLLKSNIEDSADNMA-EIVGSP 122

Human   124 PEESVPFSCDWRKVASAISPIKDQKNCNCCWAMAAAGNI--ETLWRISFWDFVDVSVQELLDC-- 184
            ...:||.|.|||. ...|:|..:|.:|..|:|.:.|.:|  :...|..  ..:.:|.|:::||  
  Fly   123 LMANVPESLDWRS-KGFITPPYNQLSCGSCYAFSIAESIMGQVFKRTG--KILSLSKQQIVDCSV 184

Human   185 GRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKYQKVAWIQDFIMLQNNEHR 249
            .....||.||.:.:....:.:..|:..::|||:  ..|..:|.......|..:..:.:|...:.:
  Fly   185 SHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPY--VARKGKCQFVPDLSVVNVTSWAILPVRDEQ 247

Human   250 IAQYLATY-GPITVTINMKP--LQLYRKGVIKATPTTCDPQLVDHSVLLVGFGSVKSEEGIWAET 311
            ..|...|: ||:.::||..|  .|||..|:.  ....|....|:|:::::|||.           
  Fly   248 AIQAAVTHIGPVAISINASPKTFQLYSDGIY--DDPLCSSASVNHAMVVIGFGK----------- 299

Human   312 VSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSNTCGITKFPLTARV 363
                         .||||||.||..|||.||.|:.:|.|.|||..:...|.|
  Fly   300 -------------DYWILKNWWGQNWGENGYIRIRKGVNMCGIANYAAYAIV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTSWNP_001326.3 Inhibitor_I29 42..98 CDD:214853 15/61 (25%)
Peptidase_C1A 129..358 CDD:239068 66/235 (28%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 15/64 (23%)
Peptidase_C1A 128..336 CDD:239068 66/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.