DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes5 and E(spl)m5-HLH

DIOPT Version :9

Sequence 1:XP_006538625.3 Gene:Hes5 / 15208 MGIID:104876 Length:415 Species:Mus musculus
Sequence 2:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster


Alignment Length:226 Identity:42/226 - (18%)
Similarity:78/226 - (34%) Gaps:87/226 - (38%)


- Green bases have known domain annotations that are detailed below.


Mouse   229 LSPKEKN------------RLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILE 281
            ::|:..|            :::||::|:.||.|:|..::.||.|: .||.......:::||::||
  Fly     1 MAPQSNNSTTFVSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLV-AEFQGDDAILRMDKAEMLE 64

Mouse   282 MAVSYLKHSKGEPGACARLLLPADVAPTARAPLMPLRLPTAFAAAAGPKSLHQDYSEGYSWCLQE 346
            .|:.:::..                ....:||:.||.:              ..:..||...:.|
  Fly    65 AALVFMRKQ----------------VVKQQAPVSPLPM--------------DSFKNGYMNAVSE 99

Mouse   347 -----------------------AVQFLTLHAASDTQMKLLYHFQRPPAPAAPA----KEPPAPG 384
                                   .|:|..:..|...|..:.....||.:||:..    .|.....
  Fly   100 ISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSA 164

Mouse   385 AAPQPARSSAKAAAAAVSTSRQPACGLWRPW 415
            |:|:|...:                 :||||
  Fly   165 ASPKPVEET-----------------MWRPW 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes5XP_006538625.3 bHLH-O_HES5 236..292 CDD:381467 17/55 (31%)
ORANGE 334..369 CDD:128787 7/57 (12%)
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 17/52 (33%)
ORANGE 87..131 CDD:128787 5/43 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830905
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10733
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.