DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes5 and h

DIOPT Version :9

Sequence 1:XP_006538625.3 Gene:Hes5 / 15208 MGIID:104876 Length:415 Species:Mus musculus
Sequence 2:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster


Alignment Length:245 Identity:61/245 - (24%)
Similarity:100/245 - (40%) Gaps:79/245 - (32%)


- Green bases have known domain annotations that are detailed below.


Mouse   189 VLGSRSRQSGTPGSVRSAPLRSLIASRAPGMAPSTVAVEMLSPKEKNRLRKPVVEKMRRDRINSS 253
            |||:    :..|..::..||:|                       ..|..||::||.||.|||:.
  Fly    13 VLGT----AVVPAQLKETPLKS-----------------------DRRSNKPIMEKRRRARINNC 50

Mouse   254 IEQLKLLL----EQEFARHQPNSKLEKADILEMAVSYLKHSKGEPGACARLLLPADVAPTARAPL 314
            :.:||.|:    :::.|||   ||||||||||..|.:|:..:                       
  Fly    51 LNELKTLILDATKKDPARH---SKLEKADILEKTVKHLQELQ----------------------- 89

Mouse   315 MPLRLPTAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHF------------ 367
               |...|...||.||.::: :..|::.|:.|..:|..:..|.  :.:||.|.            
  Fly    90 ---RQQAAMQQAADPKIVNK-FKAGFADCVNEVSRFPGIEPAQ--RRRLLQHLSNCINGVKTELH 148

Mouse   368 ---QRPPAPAAPAKEPPAPGAAPQPARSSAKAAAAAVSTSRQPACGLWRP 414
               ::....:..|:..|:|.::|: ..|...|||..:...:|.|.|.:.|
  Fly   149 QQQRQQQQQSIHAQMLPSPPSSPE-QDSQQGAAAPYLFGIQQTASGYFLP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes5XP_006538625.3 bHLH-O_HES5 236..292 CDD:381467 28/59 (47%)
ORANGE 334..369 CDD:128787 8/49 (16%)
hNP_001014577.1 HLH 29..88 CDD:238036 29/84 (35%)
ORANGE 106..141 CDD:128787 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.