DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes3 and h

DIOPT Version :9

Sequence 1:XP_011248491.1 Gene:Hes3 / 15207 MGIID:104877 Length:291 Species:Mus musculus
Sequence 2:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster


Alignment Length:205 Identity:57/205 - (27%)
Similarity:93/205 - (45%) Gaps:27/205 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    91 GTASVAQPAASERSGVLKGMGISKPLMEKKRRARINVSLEQLRSL-LERHYSHQIRKRKLEKADI 154
            |||.|  ||..:.:.:......:||:|||:||||||..|.:|::| |:.......|..|||||||
  Fly    15 GTAVV--PAQLKETPLKSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADI 77

Mouse   155 LELSVKYMRSLQNSLQGLWPV--PSGVD-YPSGFQGGLRGVSQ--RLRPGEGD----------SG 204
            ||.:||:::.||.....:...  |..|: :.:||...:..||:  .:.|.:..          :|
  Fly    78 LEKTVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCVNEVSRFPGIEPAQRRRLLQHLSNCING 142

Mouse   205 LRCPLLLQRREGS---------TTDSANPQATSVLNPCLPAIWAPSRAAGGSHSPQSPLPLPGGL 260
            ::..|..|:|:..         .:..::|:..|......|.::...:.|.|...|.....:|..|
  Fly   143 VKTELHQQQRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKL 207

Mouse   261 LESSTDVVAP 270
            ...|..:|.|
  Fly   208 PNGSIALVLP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes3XP_011248491.1 bHLH-O_HES3 117..171 CDD:381503 27/54 (50%)
hNP_001014577.1 HLH 29..88 CDD:238036 27/58 (47%)
ORANGE 106..141 CDD:128787 5/34 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.