DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes2 and cwo

DIOPT Version :9

Sequence 1:NP_001288734.1 Gene:Hes2 / 15206 MGIID:1098624 Length:157 Species:Mus musculus
Sequence 2:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster


Alignment Length:164 Identity:46/164 - (28%)
Similarity:68/164 - (41%) Gaps:34/164 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse     8 EDAAEL---RKN----LKPL----LEKRRRARINESLSQLKGLVLPLLGAETSRSSKLEKADILE 61
            ||.||.   |:|    ..||    :|||||.|:|..|:.|..|:.|..  :.....::||.:|:|
  Fly    46 EDDAEYATGRRNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQY--QRKGRGRIEKTEIIE 108

Mouse    62 MTVRFLQEQPATLYSSAAPGPLNSYLEGYRACLARLARVL------PACSVLEPAVSARLLEHLR 120
            |.:|.|:.     ..|......:.|..||..|:...|:.|      ..|..|    ..||.||:.
  Fly   109 MAIRHLKH-----LQSECQQKESDYRSGYMDCMKEAAKFLYDVHMQDFCHRL----LGRLQEHID 164

Mouse   121 QRTVSD---DSPSLTLP---PAPAPAPSPPVPPP 148
            :...:|   .:.|..:|   .|.:.:|.....||
  Fly   165 EMFKTDCYKSTRSCHMPDNVSASSGSPHQAYHPP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes2NP_001288734.1 bHLH_SF 10..73 CDD:381792 24/73 (33%)
ORANGE 85..123 CDD:128787 12/43 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 7/31 (23%)
WRPW motif 154..157
cwoNP_524775.1 HLH 66..118 CDD:306515 18/58 (31%)
ORANGE 126..168 CDD:128787 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830932
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.