DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes2 and h

DIOPT Version :9

Sequence 1:NP_001288734.1 Gene:Hes2 / 15206 MGIID:1098624 Length:157 Species:Mus musculus
Sequence 2:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster


Alignment Length:144 Identity:56/144 - (38%)
Similarity:80/144 - (55%) Gaps:20/144 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    14 RKNLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRSSKLEKADILEMTVRFLQE---QPATLY 75
            |::.||::|||||||||..|::||.|:|.....:.:|.||||||||||.||:.|||   |.|.:.
  Fly    32 RRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQ 96

Mouse    76 SSAAPGPLNSYLEGYRACLARLARVLPACSVLEPAVSARLLEHL-------------RQRTVSDD 127
            .:|.|..:|.:..|:..|:..::| .|.   :|||...|||:||             :||.....
  Fly    97 QAADPKIVNKFKAGFADCVNEVSR-FPG---IEPAQRRRLLQHLSNCINGVKTELHQQQRQQQQQ 157

Mouse   128 SPSLTLPPAPAPAP 141
            |....:.|:|..:|
  Fly   158 SIHAQMLPSPPSSP 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes2NP_001288734.1 bHLH_SF 10..73 CDD:381792 34/61 (56%)
ORANGE 85..123 CDD:128787 13/50 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 4/18 (22%)
WRPW motif 154..157
hNP_001014577.1 HLH 29..88 CDD:238036 32/55 (58%)
ORANGE 106..141 CDD:128787 12/38 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.