DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes2 and dpn

DIOPT Version :9

Sequence 1:NP_001288734.1 Gene:Hes2 / 15206 MGIID:1098624 Length:157 Species:Mus musculus
Sequence 2:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster


Alignment Length:154 Identity:56/154 - (36%)
Similarity:80/154 - (51%) Gaps:20/154 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 AELRKNLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRSSKLEKADILEMTVRFL---QEQPA 72
            |||||..||::|||||||||..|::||.|:|..:..:.:|.:||||||||||||:.|   |.|..
  Fly    38 AELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQL 102

Mouse    73 TLYSSAAPGPLNSYLEGYRACLARLARVLPACSVLEPAVSARLLEHLRQ--------RTVSDDS- 128
            .:...:.|..:..:..|:..|...:.|.:.....::..|..||..||.|        .::|:.| 
  Fly   103 NMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLNQCANSLEQIGSMSNFSN 167

Mouse   129 -------PSLTLPPAPAPA-PSPP 144
                   |:..:..||.|. ||.|
  Fly   168 GYRGGLFPATAVTAAPTPLFPSLP 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes2NP_001288734.1 bHLH_SF 10..73 CDD:381792 37/64 (58%)
ORANGE 85..123 CDD:128787 9/45 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 9/30 (30%)
WRPW motif 154..157
dpnNP_476923.1 HLH 39..101 CDD:238036 35/61 (57%)
ORANGE 114..158 CDD:128787 9/43 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.