DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes1 and E(spl)m5-HLH

DIOPT Version :9

Sequence 1:NP_032261.1 Gene:Hes1 / 15205 MGIID:104853 Length:282 Species:Mus musculus
Sequence 2:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster


Alignment Length:263 Identity:55/263 - (20%)
Similarity:98/263 - (37%) Gaps:87/263 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse    18 PASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILE 82
            |.|.|:|....|| ..:.|..||::|::||||:|:.|..||||:.:....|:.  .:::||::||
  Fly     3 PQSNNSTTFVSKT-QHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAI--LRMDKAEMLE 64

Mouse    83 MTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCM 147
            ..:..:|. |..:..|.:|  |..:..::.|:...::|::|.::....::.:|...::.||.   
  Fly    65 AALVFMRK-QVVKQQAPVS--PLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLG--- 123

Mouse   148 TQINAMTYPGQAHPALQAPPPPPPSGPAGPQHAPFAPPPPPLVPIPGGAAPPPGSAPCKLGSQAG 212
            .:...|....|...::....|.|.|                                        
  Fly   124 VEFQRMLQADQVQTSVTTSTPRPLS---------------------------------------- 148

Mouse   213 EAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTSDSMW 277
                        ||..|                    |.|::..|  .:|.||..    ..::||
  Fly   149 ------------PASSG--------------------YHSDNEDS--QSAASPKP----VEETMW 175

Mouse   278 RPW 280
            |||
  Fly   176 RPW 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes1NP_032261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 9/25 (36%)
HLH 32..95 CDD:238036 21/62 (34%)
Hairy_orange 110..148 CDD:284859 6/37 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..204 4/45 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..282 9/25 (36%)
WRPW motif 277..280 2/2 (100%)
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 19/53 (36%)
ORANGE 87..131 CDD:128787 7/46 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830873
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.