DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes1 and E(spl)m3-HLH

DIOPT Version :9

Sequence 1:NP_032261.1 Gene:Hes1 / 15205 MGIID:104853 Length:282 Species:Mus musculus
Sequence 2:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster


Alignment Length:262 Identity:68/262 - (25%)
Similarity:109/262 - (41%) Gaps:61/262 - (23%)


- Green bases have known domain annotations that are detailed below.


Mouse    33 EHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNL-QRAQM 96
            ::||..||::|::||||||:.|..||.|:::.|:::....::||||||||:||.|:|.| ||..:
  Fly    10 QYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGL 74

Mouse    97 ----------TAALSTDPSVLGKYRAGFSECMNEVTRFL---STCEGVNTEVRTRLLGHLANCMT 148
                      :...||..:.:..:|:|:....:::|:.|   ...:.:..::...|...|....|
  Fly    75 SLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIELQT 139

Mouse   149 QINAMTYPGQAHPALQAPPPPPPSGPAGPQHAPFAPPPPPLVPIPGGAAPPPGSAPCKLGSQAGE 213
            |:.......|.|...|.   |..||...             .|:.||..|...:|          
  Fly   140 QLLQQQQQQQQHQQQQI---PQSSGRLA-------------FPLLGGYGPAAAAA---------- 178

Mouse   214 AAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTSDSMWR 278
                                .|...:|..|...:...||..|.::...| |.||..|..|:.:||
  Fly   179 --------------------AISYSSFLTSKDELIDVTSVDGNALSETA-SVSSQESGASEPVWR 222

Mouse   279 PW 280
            ||
  Fly   223 PW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes1NP_032261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 4/10 (40%)
HLH 32..95 CDD:238036 31/62 (50%)
Hairy_orange 110..148 CDD:284859 6/40 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..204 10/45 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..282 10/25 (40%)
WRPW motif 277..280 2/2 (100%)
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 29/58 (50%)
ORANGE 96..136 CDD:128787 6/39 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830872
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.