DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes1 and E(spl)mbeta-HLH

DIOPT Version :9

Sequence 1:NP_032261.1 Gene:Hes1 / 15205 MGIID:104853 Length:282 Species:Mus musculus
Sequence 2:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster


Alignment Length:266 Identity:72/266 - (27%)
Similarity:110/266 - (41%) Gaps:100/266 - (37%)


- Green bases have known domain annotations that are detailed below.


Mouse    33 EHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMT 97
            ::||..||::|::||||||:.|.:||.::::.|.::....::||||||||:||:|::.| |||..
  Fly    12 QYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKL-RAQKQ 75

Mouse    98 AALST---------DP--SVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQIN 151
            ..||:         ||  |:...:|||:....|||::.|:...||:.::.|:|:.||.:.:..:.
  Fly    76 LRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNYLQ 140

Mouse   152 AMTYPGQAHPALQAPPPPPPSGPAG-PQHAP------FAPPPPPLVPIPGGAAPPPGSAPCKLGS 209
            .:.                ||.|.| |..||      ..|||.....:..||..|          
  Fly   141 VVV----------------PSLPIGVPLQAPVEDQAMVTPPPSECDSLESGACSP---------- 179

Mouse   210 QAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTSD 274
                                                                  :||..|| ||.
  Fly   180 ------------------------------------------------------APSEASS-TSG 189

Mouse   275 SMWRPW 280
            .|||||
  Fly   190 PMWRPW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes1NP_032261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 4/10 (40%)
HLH 32..95 CDD:238036 28/61 (46%)
Hairy_orange 110..148 CDD:284859 13/37 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..204 13/52 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..282 11/25 (44%)
WRPW motif 277..280 2/2 (100%)
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 30/62 (48%)
ORANGE 97..141 CDD:128787 13/43 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830871
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3263
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.