DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes1 and h

DIOPT Version :9

Sequence 1:NP_032261.1 Gene:Hes1 / 15205 MGIID:104853 Length:282 Species:Mus musculus
Sequence 2:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster


Alignment Length:356 Identity:110/356 - (30%)
Similarity:151/356 - (42%) Gaps:125/356 - (35%)


- Green bases have known domain annotations that are detailed below.


Mouse    15 AATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKAD 79
            |..||.:..||.|     ..|:|:|||||||||||||..|::||||||||.|||.:|||||||||
  Fly    17 AVVPAQLKETPLK-----SDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKAD 76

Mouse    80 ILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLA 144
            |||.|||||:.|||.|.....:.||.::.|::|||::|:|||:||    .|:....|.|||.||:
  Fly    77 ILEKTVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCVNEVSRF----PGIEPAQRRRLLQHLS 137

Mouse   145 NCMTQINAMTYPGQAHPALQAPPPPPPSGPAGPQHAPFAPPPPPLVPIPGGAAPPPGSAPCKLGS 209
            ||:..:....:..|.....|:            .||...|.||              |:|.:...
  Fly   138 NCINGVKTELHQQQRQQQQQS------------IHAQMLPSPP--------------SSPEQDSQ 176

Mouse   210 QAGEAAKVFG------------GFQVVPA--PDGQFAFLIPN----------------------- 237
            |...|..:||            |.||:|.  |:|..|.::|.                       
  Fly   177 QGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQSLPQQQQQQLLQHQQQQQQLAVA 241

Mouse   238 -----GAFAHSGPVI---PVYTSNSGTSVGPNAV----SPSSGSSLT------------------ 272
                 .|.|...|::   |..|:::|::...::.    :|.|.||.:                  
  Fly   242 AAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAPPSPANSSYEPMDIKP 306

Mouse   273 -----------------------SDSMWRPW 280
                                   .:..||||
  Fly   307 SVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes1NP_032261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 12/28 (43%)
HLH 32..95 CDD:238036 47/62 (76%)
Hairy_orange 110..148 CDD:284859 18/37 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..204 8/45 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..282 8/70 (11%)
WRPW motif 277..280 2/2 (100%)
hNP_001014577.1 HLH 29..88 CDD:238036 45/63 (71%)
ORANGE 106..141 CDD:128787 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7591
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I4310
Isobase 1 0.950 - 0 Normalized mean entropy S4933
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105205
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3450
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.820

Return to query results.
Submit another query.