DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpind1 and Spn42Dd

DIOPT Version :9

Sequence 1:NP_001317976.1 Gene:Serpind1 / 15160 MGIID:96051 Length:478 Species:Mus musculus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:375 Identity:106/375 - (28%)
Similarity:190/375 - (50%) Gaps:38/375 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse   116 LYRVLKDQATTSDNLFIAPVGISTAMGMISLGLRGETHEEVHSVLHF--RDFVNASSKYEVTTIH 178
            :|::| .::.|:.||.::||.|.|.:.|:.:|..|.|.:|:.|.|..  .|....:::|..    
  Fly    21 IYQLL-SKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGA---- 80

Mouse   179 NLFRKLTHRLFRRNFGYTLRSVNGLYIQKQFPIREDFKAAMREFYFAEAQEANFPD-PAFISKAN 242
                 |.:.|..:..|..|:..|.:|:..|:.:.:::..|:||.:.:||:..:..: |....:.|
  Fly    81 -----LLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERIN 140

Mouse   243 NHILKLTKGLIKEALENIDPAT-----QMLILNCIYFKGTWVNKFPVEMTHNHNFRLNEREVVKV 302
            ..:|..|.|.||..   |||.:     :.|::|.|||||.|.:||....|....|::...:.|.|
  Fly   141 QWVLDQTSGKIKGM---IDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPV 202

Mouse   303 SMMQTKGNFLAANDQELDCDILQLEYV-GGISMLIVVPRKLSGMKTLEAQLTPQVVERWQKSMTN 366
            .||...|.|.|...::||..:::|.|: ..:||.|.:||::.|:..||.::.     .:.:.:..
  Fly   203 QMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIV-----GFARPLVA 262

Mouse   367 RTREVLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSGISDQRIA--IDLFKHQSTITVNEEGT 429
            :...:.|||||:|....|.|.|:.:||.:||....::||:...:..  :....|::.:.|||||.
  Fly   263 KEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGA 327

Mouse   430 QAAAVTTVGFMPLSTQVRFT----VDRPFLFLVYEHRTSCLLFMGKVTNP 475
            :||..|:|.   ::.:..|:    .|.||.|::.:..|  :.|.|:|.:|
  Fly   328 EAAGATSVA---VTNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpind1NP_001317976.1 HCII 43..476 CDD:239002 106/375 (28%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 54..78
Glycosaminoglycan-binding site. /evidence=ECO:0000250 171..191 3/19 (16%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 104/370 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.