DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTSV and CG12163

DIOPT Version :9

Sequence 1:NP_001188504.1 Gene:CTSV / 1515 HGNCID:2538 Length:334 Species:Homo sapiens
Sequence 2:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster


Alignment Length:320 Identity:125/320 - (39%)
Similarity:181/320 - (56%) Gaps:19/320 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    20 KFDQNLDTKWYQWKATH-RRLYGANEEGWRRAVWEKNMKMI-ELHNGEYSQGKHGFTMAMNAFGD 82
            :||: :|..:|:::... ||.....|...|..::.:|:|.| ||:..|....|:|.|    .|.|
  Fly   300 RFDK-VDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGIT----EFAD 359

Human    83 MTNEEFRQMMGCFRNQ--KFRKGKVFREPLFL-DLPKSVDWRKKGYVTPVKNQKQCGSCWAFSAT 144
            ||:.|:::..|.::..  |...|.....|.:. :|||..|||:|..||.||||..||||||||.|
  Fly   360 MTSSEYKERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVT 424

Human   145 GALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDE 209
            |.:||....|||:|...|||.|:||...  :..||||.|..|::.:|:.|||:.|..|||.|...
  Fly   425 GNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKN 487

Human   210 ICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIY--FEPDCSS 272
            .|.:....|.....||..:..|.|.|:.:.:...||||:.::|  ::.|||:.|:.  ::..||.
  Fly   488 QCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINA--NAMQFYRGGVSHPWKALCSK 550

Human   273 KNLDHGVLVVGYGF-EGANSNNS-KYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAAS 330
            |||||||||||||. :..|.:.: .||:|||||||.||..||.::.:. :|.||::..|:
  Fly   551 KNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG-DNTCGVSEMAT 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTSVNP_001188504.1 Inhibitor_I29 29..87 CDD:214853 18/59 (31%)
Peptidase_C1 114..332 CDD:306594 99/221 (45%)
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 18/60 (30%)
Peptidase_C1A 395..611 CDD:239068 98/220 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149682
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.