DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTSV and Swim

DIOPT Version :9

Sequence 1:NP_001188504.1 Gene:CTSV / 1515 HGNCID:2538 Length:334 Species:Homo sapiens
Sequence 2:NP_611652.2 Gene:Swim / 37537 FlyBaseID:FBgn0034709 Length:431 Species:Drosophila melanogaster


Alignment Length:247 Identity:82/247 - (33%)
Similarity:116/247 - (46%) Gaps:37/247 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   114 LPKSVD----WRKKGYVTPVKNQKQCGSCWAFSATGALEGQM-FRKTGK-LVSLSEQNLVDCSRP 172
            ||.|.:    |  ..|::.|.:|..||:.|..|.|.....:. .:..|| .|.||.||::.|:|.
  Fly   187 LPSSFNALDKW--SSYISEVPDQGWCGASWVLSTTSVASDRFAIQSKGKENVQLSAQNILSCTRR 249

Human   173 QGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYR-------------PENSVANDTG 224
            |  |||.||.:..|::|:.:.|.:| |..|||....:.||.|             |.| |..|:.
  Fly   250 Q--QGCEGGHLDAAWRYLHKKGVVD-ENCYPYTQHRDTCKIRHNSRSLRANGCQKPVN-VDRDSL 310

Human   225 FTV---VAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLD--HGVLVVGY 284
            :||   .:..:|..:|..:...||:...|......|. |..|:|.|...:.|...  |.|.:||:
  Fly   311 YTVGPAYSLNREADIMAEIFHSGPVQATMRVNRDFFA-YSGGVYRETAANRKAPTGFHSVKLVGW 374

Human   285 GFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIA--TAASYPNV 334
            |.|   .|..|||:..||||..||.:||.:|.:. :|.|||.  ..||:|.|
  Fly   375 GEE---HNGEKYWIAANSWGSWWGEHGYFRILRG-SNECGIEEYVLASWPYV 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTSVNP_001188504.1 Inhibitor_I29 29..87 CDD:214853
Peptidase_C1 114..332 CDD:306594 80/243 (33%)
SwimNP_611652.2 Somatomedin_B 41..83 CDD:279385
VWC 91..>126 CDD:302663
Peptidase_C1A_CathepsinB 188..417 CDD:239111 77/239 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149687
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.