DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTSV and CtsB1

DIOPT Version :9

Sequence 1:NP_001188504.1 Gene:CTSV / 1515 HGNCID:2538 Length:334 Species:Homo sapiens
Sequence 2:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster


Alignment Length:308 Identity:85/308 - (27%)
Similarity:136/308 - (44%) Gaps:62/308 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    73 FTMAMNAFGDMTNEEFRQMMGCFRN-QKFR---KGKVFREPLFL----DLPKSVDWRKKGYVTP- 128
            :|:..|....:|....|::||...: .||.   |.:|..: |::    :||:..|.||:....| 
  Fly    39 WTVGRNFDASVTEGHIRRLMGVHPDA
HKFALPDKREVLGD-LYVNSVDELPEEFDSRKQWPNCPT 102

Human   129 ---VKNQKQCGSCWAFSATGALEGQMFRKTGKLVS--LSEQNLVDCSRPQGNQGCNGGFMARAFQ 188
               :::|..|||||||.|..|:..::...:|..|:  .|..:||.|....| .||||||...|:.
  Fly   103 IGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCG-FGCNGGFPGAAWS 166

Human   189 Y-----VKENGGLDSEES-YPYVAVDEI--CKYR--------------PENSVANDTGFTV-VAP 230
            |     :...|...|.:. .||    ||  |::.              |:.|....:|:|| .|.
  Fly   167 YWTRKGIVSGGPYGSNQGCRPY----EISPCEHHVNGTRPPCAHGGRTPKCSHVCQSGYTVDYAK 227

Human   231 GKE------------KALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNL-DHGVLVV 282
            .|.            :.:.:.:.|.||:..|... :.....||.|:|...  ..|.| .|.:.::
  Fly   228 DKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTV-YEDLILYKDGVYQHE--HGKELGGHAIRIL 289

Human   283 GYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAAS 330
            |:|..|  .....|||:.|||..:||.:|:.:|.:.: :||||.::.|
  Fly   290 GWGVWG--EEKIPYWLIGNSWNTDWGDHGFFRILRGQ-DHCGIESSIS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTSVNP_001188504.1 Inhibitor_I29 29..87 CDD:214853 3/13 (23%)
Peptidase_C1 114..332 CDD:306594 74/259 (29%)
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 6/24 (25%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 73/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149677
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.