DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTSL and CG5367

DIOPT Version :9

Sequence 1:NP_001244900.1 Gene:CTSL / 1514 HGNCID:2537 Length:333 Species:Homo sapiens
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:331 Identity:122/331 - (36%)
Similarity:199/331 - (60%) Gaps:20/331 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    14 IASATLTFDHSLEA----QWTKWKAMHNRLYGMNEEGWRR-AVWEKNMKMIELHNQEYREGKHSF 73
            |.::.|:..:|..|    ::.|:|..:||.|....:..|. ..:|:|.|:||.|||.|:||:.||
  Fly    17 IVTSNLSEGNSSSANCKSEFEKFKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQNYKEGQTSF 81

Human    74 TMAMNAFGDMTSEEF-----RQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQG 133
            .:..|.|.||:::.:     |.:.:..::......::...||....|.|:|||.||::||..||.
  Fly    82 RLKPNIFADMSTDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKGFITPPYNQL 146

Human   134 QCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDS 198
            .||||:|||...::.||:|::||:::|||:|.:||||...||:||.||.:.....|:|..||:..
  Fly   147 SCGSCYAFSIAESIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMR 211

Human   199 EESYPYEATEESCKYNPKYSVANDTGFVDIP-KQEKALMKAVATVGPISVAIDAGHESFLFYKEG 262
            ::.|||.|.:..|::.|..||.|.|.:..:| :.|:|:..||..:||::::|:|..::|..|.:|
  Fly   212 DQDYPYVARKGKCQFVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDG 276

Human   263 IYFEPDCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASA 327
            ||.:|.|||..::|.::|:|:|        ..||::||.||:.||..||:::.|. .|.||||:.
  Fly   277 IYDDPLCSSASVNHAMVVIGFG--------KDYWILKNWWGQNWGENGYIRIRKG-VNMCGIANY 332

Human   328 ASYPTV 333
            |:|..|
  Fly   333 AAYAIV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTSLNP_001244900.1 Inhibitor_I29 29..87 CDD:214853 23/58 (40%)
Peptidase_C1 114..332 CDD:395062 91/218 (42%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 23/59 (39%)
Peptidase_C1A 128..336 CDD:239068 90/216 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149667
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.