DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTSK and CG5367

DIOPT Version :9

Sequence 1:NP_000387.1 Gene:CTSK / 1513 HGNCID:2536 Length:329 Species:Homo sapiens
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:311 Identity:115/311 - (36%)
Similarity:179/311 - (57%) Gaps:17/311 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    24 THWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQ 88
            :.:|.:|..:.::|....||:.....:|:|.|.|..||.....|..::.|..|...||:::..::
  Fly    34 SEFEKFKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQNYKEGQTSFRLKPNIFADMSTDGYLK 98

Human    89 K-MTGLKVPLSHSRSNDTLYIPEWEG-----RAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGA 147
            . :..||..:..|..|    :.|..|     ..|:|:|:|.||::||..||..||||:|||...:
  Fly    99 GFLRLLKSNIEDSADN----MAEIVGSPLMANVPESLDWRSKGFITPPYNQLSCGSCYAFSIAES 159

Human   148 LEGQLKKKTGKLLNLSPQNLVDC-VSE-NDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESC 210
            :.||:.|:|||:|:||.|.:||| ||. |.||.||.:.|...|:|...||..:..||||.::..|
  Fly   160 IMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARKGKC 224

Human   211 MYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLN 275
            .:.|.........:..:|..:|:|::.||..:|||:::|:||..:||.||.|:|.|..|:|.::|
  Fly   225 QFVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSASVN 289

Human   276 HAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF 326
            ||::.:|:    |..:||:||.||:|||..|||.: |...|.|||||.|::
  Fly   290 HAMVVIGF----GKDYWILKNWWGQNWGENGYIRI-RKGVNMCGIANYAAY 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTSKNP_000387.1 Inhibitor_I29 26..85 CDD:214853 16/58 (28%)
Peptidase_C1 115..327 CDD:306594 93/214 (43%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 16/59 (27%)
Peptidase_C1A 128..336 CDD:239068 93/213 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.