DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTSH and CG5367

DIOPT Version :9

Sequence 1:NP_004381.2 Gene:CTSH / 1512 HGNCID:2535 Length:335 Species:Homo sapiens
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:317 Identity:110/317 - (34%)
Similarity:160/317 - (50%) Gaps:21/317 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    26 CVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHN----NGNHTFKMALNQFSDMS 86
            |.:..|||.    .:.:||...|.:.....:.|..|::.|..||    .|..:|::..|.|:|||
  Fly    32 CKSEFEKFK----NNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQNYKEGQTSFRLKPNIFADMS 92

Human    87 FAEIKHKYLWSEPQNCSATKSNYLRGTGP-----YPPSVDWRKKGNFVSPVKNQGACGSCWTFST 146
            .......:|.....|...:..|.....|.     .|.|:|||.|| |::|..||.:||||:.||.
  Fly    93 TDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKG-FITPPYNQLSCGSCYAFSI 156

Human   147 TGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKD 211
            ..::...:...|||:|||::||:|||:....|.||.||.......|:....|||.:..|||..:.
  Fly   157 AESIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARK 221

Human   212 GYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVT-QDFMMYRTGIYSSTSCHKT 275
            |.|:|.|..::..|...|.:.:.||:|:..||....||:.:...: :.|.:|..|||....|...
  Fly   222 GKCQFVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSA 286

Human   276 PDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPI 332
              .||||::.:|:|:    .|||:||.||..||.|||..|.:|.||||:|..|:|.|
  Fly   287 --SVNHAMVVIGFGK----DYWILKNWWGQNWGENGYIRIRKGVNMCGIANYAAYAI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTSHNP_004381.2 Inhibitor_I29 35..90 CDD:285458 15/58 (26%)
Peptidase_C1 117..332 CDD:278538 86/215 (40%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 18/63 (29%)
Peptidase_C1A 128..336 CDD:239068 85/214 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.