DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand2 and twi

DIOPT Version :9

Sequence 1:NP_034532.3 Gene:Hand2 / 15111 MGIID:103580 Length:217 Species:Mus musculus
Sequence 2:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster


Alignment Length:181 Identity:59/181 - (32%)
Similarity:84/181 - (46%) Gaps:44/181 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse     8 PH---HPVVH--------HEGYPFAAAAAAAAAAAASRCSHEENPYF-HGWLIGHPEMSPPDYSM 60
            ||   |..:|        .|||..|.:...:|.:::.|   ::..|. |..|....:::....|.
  Fly   256 PHQQSHAQMHFQNAYRQSFEGYEPANSLNGSAYSSSDR---DDMEYARHNALSSVSDLNGGVMSP 317

Mouse    61 ALSYSPEYASGAAG--LDHSHYGGVPPGAGPPGLGGPR------PVK---------RRGTANRKE 108
            |....    .|:||  ||.|..||       .....||      |.|         :|..||.:|
  Fly   318 ACLAD----DGSAGSLLDGSDAGG-------KAFRKPRRRLKRKPSKTEETDEFSNQRVMANVRE 371

Mouse   109 RRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDD 159
            |:||||:|.||..|::.||.:|:| |||||:||:|||.||.:|..:|:..|
  Fly   372 RQRTQSLNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLSSSD 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hand2NP_034532.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..116 17/54 (31%)
bHLH_TS_HAND2 100..161 CDD:381477 32/60 (53%)
twiNP_001033967.1 HLH 363..413 CDD:278439 29/50 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5507
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.830

Return to query results.
Submit another query.