DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand1 and twi

DIOPT Version :9

Sequence 1:NP_032239.1 Gene:Hand1 / 15110 MGIID:103577 Length:216 Species:Mus musculus
Sequence 2:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster


Alignment Length:146 Identity:49/146 - (33%)
Similarity:73/146 - (50%) Gaps:16/146 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse    46 LLSPADAAPDFPAGGPPPTTAVAAAAY-GPDARPSQSPGRLEALGSRLPKRKGSGPKKERRRTES 109
            ::|||..|.|..||.....:.....|: .|..|..:.|.:.|.. .....::.....:||:||:|
  Fly   314 VMSPACLADDGSAGSLLDGSDAGGKAFRKPRRRLKRKPSKTEET-DEFSNQRVMANVRERQRTQS 377

Mouse   110 INSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVL---------AKDAQAGDPEAF--- 162
            :|.||..|::.||.:|:| |||||:||:|||.||.:|..:|         |.:|| |.|.|:   
  Fly   378 LNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQ-GSPSAYGSA 440

Mouse   163 KAELKKTDGGRESKRK 178
            .:.|.....|.|:..|
  Fly   441 SSLLSAAANGAEADLK 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hand1NP_032239.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 13/56 (23%)
HLH 103..152 CDD:197674 27/57 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203 4/14 (29%)
twiNP_001033967.1 HLH 363..413 CDD:278439 25/50 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839651
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.800

Return to query results.
Submit another query.