DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand1 and CG33557

DIOPT Version :9

Sequence 1:NP_032239.1 Gene:Hand1 / 15110 MGIID:103577 Length:216 Species:Mus musculus
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:114 Identity:43/114 - (37%)
Similarity:64/114 - (56%) Gaps:11/114 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse    42 FQSWLLSPADAAPDFPAGGPPPTTAVAAAAYGPDARPSQ--SPGRLEALGS---RLPKRKGSGPK 101
            |.::|:  |..|.|..:.|  ..:...|||...|::..|  :||..|..|:   |.|::|.:.  
  Fly    10 FSNYLM--AVFAQDSNSSG--SASGSGAAADSEDSQIGQEANPGGQENQGNHRRRPPRQKINA-- 68

Mouse   102 KERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVL 150
            :||.||.::|||:..||..||..|.:.|||||:.:|||:|||.:|...|
  Fly    69 RERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hand1NP_032239.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 19/60 (32%)
HLH 103..152 CDD:197674 25/48 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203
CG33557NP_001014730.1 HLH 67..119 CDD:197674 25/53 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839649
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.