DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand1 and HLH4C

DIOPT Version :9

Sequence 1:NP_032239.1 Gene:Hand1 / 15110 MGIID:103577 Length:216 Species:Mus musculus
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:118 Identity:43/118 - (36%)
Similarity:55/118 - (46%) Gaps:19/118 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse    57 PAGGPPPTTAVAAAAYGPDARPSQ----SPGRLEALGSRLPKRKGSGPKK--------ERRRTES 109
            ||..||||.|       |..|.:.    .|..|..|.....:|:.....|        ||.|.|:
  Fly    66 PAPPPPPTPA-------PRRRTTPIAHLDPSELVGLSREERRRRRRATLKYRTAHATRERIRVEA 123

Mouse   110 INSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQAGDPEAF 162
            .|.:|||||:.:|.:|.|.|||||:.|:||..|||||..||.....:....:|
  Fly   124 FNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLETPXDSAGASSF 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hand1NP_032239.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 17/63 (27%)
HLH 103..152 CDD:197674 28/48 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 28/56 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.